Recombinant Human CHRNA3 protein, His-SUMO & Myc-tagged
Cat.No. : | CHRNA3-2697H |
Product Overview : | Recombinant Human CHRNA3 protein(P32297)(32-240aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 32-240aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.6 kDa |
AA Sequence : | SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CHRNA3 cholinergic receptor, nicotinic, alpha 3 (neuronal) [ Homo sapiens ] |
Official Symbol | CHRNA3 |
Synonyms | CHRNA3; cholinergic receptor, nicotinic, alpha 3 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 3; neuronal acetylcholine receptor subunit alpha-3; acetylcholine receptor; nicotinic; alpha 3 (neuronal); neuronal nicotinic acetylcholine receptor, alpha3 subunit; LNCR2; PAOD2; NACHRA3; MGC104879; |
Gene ID | 1136 |
mRNA Refseq | NM_000743 |
Protein Refseq | NP_000734 |
MIM | 118503 |
UniProt ID | P32297 |
◆ Recombinant Proteins | ||
CHRNA3-3226HF | Recombinant Full Length Human CHRNA3 Protein, GST-tagged | +Inquiry |
CHRNA3-11211H | Recombinant Human CHRNA3, GST-tagged | +Inquiry |
CHRNA3-1723H | Recombinant Human CHRNA3 Protein (Ser32-Leu240), N-His tagged | +Inquiry |
CHRNA3-2697H | Recombinant Human CHRNA3 protein, His-SUMO & Myc-tagged | +Inquiry |
CHRNA3-1280H | Recombinant Human CHRNA3 Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNA3 Products
Required fields are marked with *
My Review for All CHRNA3 Products
Required fields are marked with *