Recombinant Human CHRNA3 protein, His-SUMO & Myc-tagged

• Cat.No.: CHRNA3-2697H
• Product Overview: Recombinant Human CHRNA3 protein(P32297)(32-240aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc&SUMO
• Protein Length: 32-240aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 44.6 kDa
• AA Sequence: SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CHRNA3 cholinergic receptor, nicotinic, alpha 3 (neuronal) [ Homo sapiens ]
• Official Symbol: CHRNA3
• Synonyms: CHRNA3; cholinergic receptor, nicotinic, alpha 3 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 3; neuronal acetylcholine receptor subunit alpha-3; acetylcholine receptor; nicotinic; alpha 3 (neuronal); neuronal nicotinic acetylcholine receptor, alpha3 subunit; LNCR2; PAOD2; NACHRA3; MGC104879
• Gene ID: 1136
• mRNA Refseq: NM_000743
• Protein Refseq: NP_000734
• MIM: 118503
• UniProt ID: P32297