Recombinant Human CHST2 Protein, GST-tagged

Cat.No. : CHST2-1342H
Product Overview : Human CHST2 partial ORF ( NP_004258, 431 a.a. - 530 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This locus encodes a sulfotransferase protein. The encoded enzyme catalyzes the sulfation of a nonreducing N-acetylglucosamine residue, and may play a role in biosynthesis of 6-sulfosialyl Lewis X antigen. [provided by RefSeq, Aug 2011]
Molecular Mass : 36.74 kDa
AA Sequence : DPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHST2 carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2 [ Homo sapiens ]
Official Symbol CHST2
Synonyms CHST2; carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2; carbohydrate sulfotransferase 2; C6ST; N-acetylglucosamine 6-O-sulfotransferase 1; carbohydrate (chondroitin 6/keratan) sulfotransferase 2; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 2; GST2; GST-2; Gn6ST-1; glcNAc6ST-1;
Gene ID 9435
mRNA Refseq NM_004267
Protein Refseq NP_004258
MIM 603798
UniProt ID Q9Y4C5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHST2 Products

Required fields are marked with *

My Review for All CHST2 Products

Required fields are marked with *

0
cart-icon