Recombinant Human CHST2 Protein, GST-tagged
| Cat.No. : | CHST2-1342H |
| Product Overview : | Human CHST2 partial ORF ( NP_004258, 431 a.a. - 530 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This locus encodes a sulfotransferase protein. The encoded enzyme catalyzes the sulfation of a nonreducing N-acetylglucosamine residue, and may play a role in biosynthesis of 6-sulfosialyl Lewis X antigen. [provided by RefSeq, Aug 2011] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | DPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CHST2 carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2 [ Homo sapiens ] |
| Official Symbol | CHST2 |
| Synonyms | CHST2; carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2; carbohydrate sulfotransferase 2; C6ST; N-acetylglucosamine 6-O-sulfotransferase 1; carbohydrate (chondroitin 6/keratan) sulfotransferase 2; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 2; GST2; GST-2; Gn6ST-1; glcNAc6ST-1; |
| Gene ID | 9435 |
| mRNA Refseq | NM_004267 |
| Protein Refseq | NP_004258 |
| MIM | 603798 |
| UniProt ID | Q9Y4C5 |
| ◆ Recombinant Proteins | ||
| CHST2-869R | Recombinant Rhesus monkey CHST2 Protein, His-tagged | +Inquiry |
| CHST2-1342H | Recombinant Human CHST2 Protein, GST-tagged | +Inquiry |
| CHST2-1675M | Recombinant Mouse CHST2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHST2-01H | Recombinant Human CHST2 Protein (AA 76-530), N-6×His/GFP tagged | +Inquiry |
| CHST2-695R | Recombinant Rhesus Macaque CHST2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHST2 Products
Required fields are marked with *
My Review for All CHST2 Products
Required fields are marked with *
