Recombinant Human CHSY1 Protein, GST-tagged
Cat.No. : | CHSY1-1348H |
Product Overview : | Human CHSY1 partial ORF ( NP_055733.2, 516 a.a. - 624 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the chondroitin N-acetylgalactosaminyltransferase family. These enzymes possess dual glucuronyltransferase and galactosaminyltransferase activity and play critical roles in the biosynthesis of chondroitin sulfate, a glycosaminoglycan involved in many biological processes including cell proliferation and morphogenesis. Decreased expression of this gene may play a role in colorectal cancer, and mutations in this gene are a cause of temtamy preaxial brachydactyly syndrome. [provided by RefSeq, Dec 2011] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | PFQLPGSKSEHKEPKDKKINILIPLSGRFDMFVRFMGNFEKTCLIPNQNVKLVVLLFNSDSNPDKAKQVELMRDYRIKYPKADMQILPVSGEFSRALALEVGSSQFNNE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHSY1 chondroitin sulfate synthase 1 [ Homo sapiens ] |
Official Symbol | CHSY1 |
Synonyms | CHSY1; chondroitin sulfate synthase 1; carbohydrate (chondroitin) synthase 1; CSS1; KIAA0990; chondroitin synthase 1; carbohydrate synthase 1; chondroitin glucuronyltransferase 1; N-acetylgalactosaminyltransferase II; chondroitin glucuronyltransferase II; N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 1; glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase 1; CHSY; TPBS; ChSy-1; FLJ58581; DKFZp434M032; |
Gene ID | 22856 |
mRNA Refseq | NM_014918 |
Protein Refseq | NP_055733 |
MIM | 608183 |
UniProt ID | Q86X52 |
◆ Recombinant Proteins | ||
CHSY1-1679M | Recombinant Mouse CHSY1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHSY1-3458M | Recombinant Mouse CHSY1 Protein | +Inquiry |
Chsy1-784M | Recombinant Mouse Chsy1 Protein, His&GST-tagged | +Inquiry |
CHSY1-11235H | Recombinant Human CHSY1, GST-tagged | +Inquiry |
CHSY1-11954Z | Recombinant Zebrafish CHSY1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHSY1 Products
Required fields are marked with *
My Review for All CHSY1 Products
Required fields are marked with *
0
Inquiry Basket