Recombinant Human CHSY1 Protein, GST-tagged

Cat.No. : CHSY1-1348H
Product Overview : Human CHSY1 partial ORF ( NP_055733.2, 516 a.a. - 624 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the chondroitin N-acetylgalactosaminyltransferase family. These enzymes possess dual glucuronyltransferase and galactosaminyltransferase activity and play critical roles in the biosynthesis of chondroitin sulfate, a glycosaminoglycan involved in many biological processes including cell proliferation and morphogenesis. Decreased expression of this gene may play a role in colorectal cancer, and mutations in this gene are a cause of temtamy preaxial brachydactyly syndrome. [provided by RefSeq, Dec 2011]
Molecular Mass : 37.73 kDa
AA Sequence : PFQLPGSKSEHKEPKDKKINILIPLSGRFDMFVRFMGNFEKTCLIPNQNVKLVVLLFNSDSNPDKAKQVELMRDYRIKYPKADMQILPVSGEFSRALALEVGSSQFNNE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHSY1 chondroitin sulfate synthase 1 [ Homo sapiens ]
Official Symbol CHSY1
Synonyms CHSY1; chondroitin sulfate synthase 1; carbohydrate (chondroitin) synthase 1; CSS1; KIAA0990; chondroitin synthase 1; carbohydrate synthase 1; chondroitin glucuronyltransferase 1; N-acetylgalactosaminyltransferase II; chondroitin glucuronyltransferase II; N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 1; glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase 1; CHSY; TPBS; ChSy-1; FLJ58581; DKFZp434M032;
Gene ID 22856
mRNA Refseq NM_014918
Protein Refseq NP_055733
MIM 608183
UniProt ID Q86X52

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHSY1 Products

Required fields are marked with *

My Review for All CHSY1 Products

Required fields are marked with *

0
cart-icon