Recombinant Human CHTOP Protein, GST-tagged
Cat.No. : | CHTOP-1350H |
Product Overview : | Human CHTOP full-length ORF ( NP_056422.2, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Nov 2015] |
Molecular Mass : | 52.8 kDa |
AA Sequence : | MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPTPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALKLKQSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHTOP chromatin target of PRMT1 [ Homo sapiens ] |
Official Symbol | CHTOP |
Synonyms | CHTOP; chromatin target of PRMT1; C1orf77, chromosome 1 open reading frame 77; chromatin target of PRMT1 protein; DKFZP547E1010; FOP; Friend of Prmt1; small protein rich in arginine and glycine; SRAG; friend of PRMT1 protein; SRAG-3; SRAG-5; pp7704; C1orf77; FL-SRAG; RP1-178F15.2; FLJ40551; MGC86949; MGC131924; DKFZp547E1010; |
Gene ID | 26097 |
mRNA Refseq | NM_001206612 |
Protein Refseq | NP_001193541 |
MIM | 614206 |
UniProt ID | Q9Y3Y2 |
◆ Recombinant Proteins | ||
CHTOP-2918HFL | Recombinant Full Length Human CHTOP protein, Flag-tagged | +Inquiry |
CHTOP-3461M | Recombinant Mouse CHTOP Protein | +Inquiry |
CHTOP-699R | Recombinant Rhesus Macaque CHTOP Protein, His (Fc)-Avi-tagged | +Inquiry |
CHTOP-1350H | Recombinant Human CHTOP Protein, GST-tagged | +Inquiry |
CHTOP-01H | Recombinant Human CHTOP protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHTOP-8146HCL | Recombinant Human C1orf77 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHTOP Products
Required fields are marked with *
My Review for All CHTOP Products
Required fields are marked with *
0
Inquiry Basket