"CHTOP" Related Products

Recombinant Human CHTOP Protein, GST-tagged

Cat.No. : CHTOP-1350H
Product Overview : Human CHTOP full-length ORF ( NP_056422.2, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Nov 2015]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 52.8 kDa
AA Sequence : MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPTPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALKLKQSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : CHTOP chromatin target of PRMT1 [ Homo sapiens ]
Official Symbol : CHTOP
Synonyms : CHTOP; chromatin target of PRMT1; C1orf77, chromosome 1 open reading frame 77; chromatin target of PRMT1 protein; DKFZP547E1010; FOP; Friend of Prmt1; small protein rich in arginine and glycine; SRAG; friend of PRMT1 protein; SRAG-3; SRAG-5; pp7704; C1orf77; FL-SRAG; RP1-178F15.2; FLJ40551; MGC86949; MGC131924; DKFZp547E1010;
Gene ID : 26097
mRNA Refseq : NM_001206612
Protein Refseq : NP_001193541
MIM : 614206
UniProt ID : Q9Y3Y2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.