Recombinant Human CHTOP protein, GST-tagged
| Cat.No. : | CHTOP-1862H |
| Product Overview : | Recombinant Human CHTOP protein(1 - 118 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 13, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1 - 118 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CHTOP chromatin target of PRMT1 [ Homo sapiens ] |
| Official Symbol | CHTOP |
| Synonyms | CHTOP; chromatin target of PRMT1; C1orf77, chromosome 1 open reading frame 77; chromatin target of PRMT1 protein; DKFZP547E1010; FOP; Friend of Prmt1; small protein rich in arginine and glycine; SRAG; friend of PRMT1 protein; SRAG-3; SRAG-5; pp7704; C1orf77; FL-SRAG; RP1-178F15.2; FLJ40551; MGC86949; MGC131924; DKFZp547E1010; |
| Gene ID | 26097 |
| mRNA Refseq | NM_001206612 |
| Protein Refseq | NP_001193541 |
| MIM | 614206 |
| UniProt ID | Q9Y3Y2 |
| ◆ Recombinant Proteins | ||
| CHTOP-2918HFL | Recombinant Full Length Human CHTOP protein, Flag-tagged | +Inquiry |
| CHTOP-699R | Recombinant Rhesus Macaque CHTOP Protein, His (Fc)-Avi-tagged | +Inquiry |
| Chtop-2161M | Recombinant Mouse Chtop Protein, Myc/DDK-tagged | +Inquiry |
| CHTOP-1350H | Recombinant Human CHTOP Protein, GST-tagged | +Inquiry |
| CHTOP-3461M | Recombinant Mouse CHTOP Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHTOP-8146HCL | Recombinant Human C1orf77 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHTOP Products
Required fields are marked with *
My Review for All CHTOP Products
Required fields are marked with *
