Recombinant Human Chymase 1, His tagged

• Cat.No.: CMA1-723H
• Product Overview: Recombinant Human Chymase 1 with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 22-247 aa
• Description: This gene encodes a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and is thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the generation of vasoactive peptides. In the heart and blood vessels, this protein, rather than angiotensin converting enzyme, is largely responsible for converting angiotensin I to the vasoactive peptide angiotensin II. Alternative splicing results in multiple variants.
• Form: Sterile 20mM Tris, pH8.0, 150mM NaCl, 0.1% SKL
• Molecular Mass: 27 kDa
• AASequence: MHHHHHHHHENLYFQGSIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.2 mg/mL by BCA

Gene Information

• Gene Name: CMA1 chymase 1, mast cell [ Homo sapiens (human) ]
• Official Symbol: CMA1
• Synonyms: CMA1; chymase 1, mast cell; chymase; alpha-chymase; chymase, heart; chymase, mast cell; mast cell protease I; chymase 1 preproprotein transcript E; chymase 1 preproprotein transcript I; CYH; MCT1; MGC119890; MGC119891
• Gene ID: 1215
• mRNA Refseq: NM_001836
• Protein Refseq: NP_001827
• MIM: 118938
• UniProt ID: P23946