Recombinant Human CIAPIN1 protein, His-SUMO-tagged
Cat.No. : | CIAPIN1-4546H |
Product Overview : | Recombinant Human CIAPIN1 protein(Q6FI81)(1-312aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-312aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 49.6 kDa |
AA Sequence : | MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CIAPIN1 cytokine induced apoptosis inhibitor 1 [ Homo sapiens ] |
Official Symbol | CIAPIN1 |
Synonyms | CIAPIN1; cytokine induced apoptosis inhibitor 1; anamorsin; Anamorsin; predicted protein of HQ0915; cytokine-induced apoptosis inhibitor 1; fe-S cluster assembly protein DRE2 homolog; DRE2; PRO0915; 2810413N20Rik; |
Gene ID | 57019 |
mRNA Refseq | NM_020313 |
Protein Refseq | NP_064709 |
MIM | 608943 |
UniProt ID | Q6FI81 |
◆ Recombinant Proteins | ||
CIAPIN1-4546H | Recombinant Human CIAPIN1 protein, His-SUMO-tagged | +Inquiry |
CIAPIN1-1411R | Recombinant Rat CIAPIN1 Protein | +Inquiry |
CIAPIN1-1839HF | Recombinant Full Length Human CIAPIN1 Protein, GST-tagged | +Inquiry |
CIAPIN1-7230H | Recombinant Human CIAPIN1, His-tagged | +Inquiry |
CIAPIN1-4886H | Recombinant Human CIAPIN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CIAPIN1-7500HCL | Recombinant Human CIAPIN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CIAPIN1 Products
Required fields are marked with *
My Review for All CIAPIN1 Products
Required fields are marked with *
0
Inquiry Basket