Recombinant Human CIAPIN1 protein, His-SUMO-tagged

Cat.No. : CIAPIN1-4546H
Product Overview : Recombinant Human CIAPIN1 protein(Q6FI81)(1-312aa), fused to N-terminal His-SUMO tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-312aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 49.6 kDa
AA Sequence : MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CIAPIN1 cytokine induced apoptosis inhibitor 1 [ Homo sapiens ]
Official Symbol CIAPIN1
Synonyms CIAPIN1; cytokine induced apoptosis inhibitor 1; anamorsin; Anamorsin; predicted protein of HQ0915; cytokine-induced apoptosis inhibitor 1; fe-S cluster assembly protein DRE2 homolog; DRE2; PRO0915; 2810413N20Rik;
Gene ID 57019
mRNA Refseq NM_020313
Protein Refseq NP_064709
MIM 608943
UniProt ID Q6FI81

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CIAPIN1 Products

Required fields are marked with *

My Review for All CIAPIN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon