Recombinant Human CIRBP
Cat.No. : | CIRBP-27251TH |
Product Overview : | Recombinant full length Human CIRBP with N-terminal proprietary tag. Predicted MW 45.03kDa. |
- Specification
- Gene Information
- Related Products
Description : | Cold-inducible RNA-binding protein is a protein that in humans is encoded by the CIRBP gene. |
Protein length : | 172 amino acids |
Molecular Weight : | 45.030kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKD RETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVD QAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGD RGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSY RDSYDSYATHNE |
Sequence Similarities : | Contains 1 RRM (RNA recognition motif) domain. |
Gene Name : | CIRBP cold inducible RNA binding protein [ Homo sapiens ] |
Official Symbol : | CIRBP |
Synonyms : | CIRBP; cold inducible RNA binding protein; cold-inducible RNA-binding protein; CIRP; Cold inducible RNA binding protein; glycine rich RNA binding protein; |
Gene ID : | 1153 |
mRNA Refseq : | NM_001280 |
Protein Refseq : | NP_001271 |
MIM : | 602649 |
Uniprot ID : | Q14011 |
Chromosome Location : | 19p13.3 |
Function : | RNA binding; SSU rRNA binding; mRNA 3-UTR binding; nucleotide binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
Cirbp-891M | Recombinant Mouse Cirbp Protein, MYC/DDK-tagged | +Inquiry |
CIRBP-1695M | Recombinant Mouse CIRBP Protein, His (Fc)-Avi-tagged | +Inquiry |
CIRBP-706R | Recombinant Rhesus Macaque CIRBP Protein, His (Fc)-Avi-tagged | +Inquiry |
CIRBP-880R | Recombinant Rhesus monkey CIRBP Protein, His-tagged | +Inquiry |
CIRBP-3479M | Recombinant Mouse CIRBP Protein | +Inquiry |
◆ Lysates | ||
CIRBP-7491HCL | Recombinant Human CIRBP 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket