Recombinant Human CIRBP
| Cat.No. : | CIRBP-27251TH |
| Product Overview : | Recombinant full length Human CIRBP with N-terminal proprietary tag. Predicted MW 45.03kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 172 amino acids |
| Description : | Cold-inducible RNA-binding protein is a protein that in humans is encoded by the CIRBP gene. |
| Molecular Weight : | 45.030kDa inclusive of tags |
| Tissue specificity : | Ubiquitous. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKD RETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVD QAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGD RGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSY RDSYDSYATHNE |
| Sequence Similarities : | Contains 1 RRM (RNA recognition motif) domain. |
| Gene Name | CIRBP cold inducible RNA binding protein [ Homo sapiens ] |
| Official Symbol | CIRBP |
| Synonyms | CIRBP; cold inducible RNA binding protein; cold-inducible RNA-binding protein; CIRP; Cold inducible RNA binding protein; glycine rich RNA binding protein; |
| Gene ID | 1153 |
| mRNA Refseq | NM_001280 |
| Protein Refseq | NP_001271 |
| MIM | 602649 |
| Uniprot ID | Q14011 |
| Chromosome Location | 19p13.3 |
| Function | RNA binding; SSU rRNA binding; mRNA 3-UTR binding; nucleotide binding; protein binding; |
| ◆ Recombinant Proteins | ||
| CIRBP-6455HFL | Recombinant Full Length Human CIRBP protein, Flag-tagged | +Inquiry |
| CIRBP-82HF | Recombinant Full Length Human CIRBP Protein | +Inquiry |
| CIRBP-3001C | Recombinant Chicken CIRBP | +Inquiry |
| CIRBP-604H | Recombinant Human CIRBP Protein, His-tagged | +Inquiry |
| CIRBP-27251TH | Recombinant Human CIRBP | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CIRBP-7491HCL | Recombinant Human CIRBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CIRBP Products
Required fields are marked with *
My Review for All CIRBP Products
Required fields are marked with *
