Recombinant Human CITED1 Protein, GST-tagged
| Cat.No. : | CITED1-1385H |
| Product Overview : | Human CITED1 full-length ORF ( AAH04240, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009] |
| Molecular Mass : | 46.97 kDa |
| AA Sequence : | MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CITED1 Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 [ Homo sapiens ] |
| Official Symbol | CITED1 |
| Synonyms | CITED1; Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1; MSG1; cbp/p300-interacting transactivator 1; melanocyte-specific gene 1; melanocyte-specific protein 1; |
| Gene ID | 4435 |
| mRNA Refseq | NM_001144885 |
| Protein Refseq | NP_001138357 |
| MIM | 300149 |
| UniProt ID | Q99966 |
| ◆ Recombinant Proteins | ||
| CITED1-1385H | Recombinant Human CITED1 Protein, GST-tagged | +Inquiry |
| CITED1-1701M | Recombinant Mouse CITED1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CITED1-3486M | Recombinant Mouse CITED1 Protein | +Inquiry |
| CITED1-1712H | Recombinant Human CITED1 protein, His & T7-tagged | +Inquiry |
| CITED1-883R | Recombinant Rhesus monkey CITED1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CITED1-7487HCL | Recombinant Human CITED1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CITED1 Products
Required fields are marked with *
My Review for All CITED1 Products
Required fields are marked with *
