Recombinant Human CKM protein(21-120 aa), C-His-tagged

Cat.No. : CKM-2571H
Product Overview : Recombinant Human CKM protein(P06732)(21-120 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 21-120 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 14 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : PDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDD
Gene Name CKM creatine kinase, muscle [ Homo sapiens ]
Official Symbol CKM
Synonyms CKM; creatine kinase, muscle; CKMM; creatine kinase M-type; creatine kinase-M; creatine kinase M chain; M-CK;
Gene ID 1158
mRNA Refseq NM_001824
Protein Refseq NP_001815
MIM 123310
UniProt ID P06732

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CKM Products

Required fields are marked with *

My Review for All CKM Products

Required fields are marked with *

0
cart-icon