Recombinant Human CKM protein(21-120 aa), C-His-tagged
Cat.No. : | CKM-2571H |
Product Overview : | Recombinant Human CKM protein(P06732)(21-120 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-120 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 14 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | PDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDD |
Gene Name | CKM creatine kinase, muscle [ Homo sapiens ] |
Official Symbol | CKM |
Synonyms | CKM; creatine kinase, muscle; CKMM; creatine kinase M-type; creatine kinase-M; creatine kinase M chain; M-CK; |
Gene ID | 1158 |
mRNA Refseq | NM_001824 |
Protein Refseq | NP_001815 |
MIM | 123310 |
UniProt ID | P06732 |
◆ Recombinant Proteins | ||
CKM-7056C | Recombinant Chicken CKM | +Inquiry |
CKM-1078R | Recombinant Rat CKM Protein, His (Fc)-Avi-tagged | +Inquiry |
CKM-3533C | Recombinant Cat CKM protein | +Inquiry |
CKM-757P | Recombinant Pig CKM protein, His & GST-tagged | +Inquiry |
CKM-116H | Recombinant Human CKM, His tagged | +Inquiry |
◆ Native Proteins | ||
CKM-5306H | Native Human creatine kinase, muscle | +Inquiry |
CKM-5305H | Native Human creatine kinase, muscle | +Inquiry |
CKMM-166M | Native Mouse Creatine Kinase MM | +Inquiry |
CKM-26522TH | Native Human CKM | +Inquiry |
CKM-368P | Native Pig Creatine Kinase, Muscle | +Inquiry |
◆ Cell & Tissue Lysates | ||
CKM-7483HCL | Recombinant Human CKM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CKM Products
Required fields are marked with *
My Review for All CKM Products
Required fields are marked with *