Recombinant Human CKM protein(21-120 aa), C-His-tagged
| Cat.No. : | CKM-2571H |
| Product Overview : | Recombinant Human CKM protein(P06732)(21-120 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 21-120 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 14 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | PDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDD |
| Gene Name | CKM creatine kinase, muscle [ Homo sapiens ] |
| Official Symbol | CKM |
| Synonyms | CKM; creatine kinase, muscle; CKMM; creatine kinase M-type; creatine kinase-M; creatine kinase M chain; M-CK; |
| Gene ID | 1158 |
| mRNA Refseq | NM_001824 |
| Protein Refseq | NP_001815 |
| MIM | 123310 |
| UniProt ID | P06732 |
| ◆ Recombinant Proteins | ||
| CKM-198H | Recombinant Human Creatine Kinase, Muscle, Type3 | +Inquiry |
| CKM-1865HF | Recombinant Full Length Human CKM Protein, GST-tagged | +Inquiry |
| CKM-932H | Recombinant Human Creatine Kinase, Muscle | +Inquiry |
| CKM-1397H | Recombinant Human CKM Protein, GST-tagged | +Inquiry |
| CKM-7056C | Recombinant Chicken CKM | +Inquiry |
| ◆ Native Proteins | ||
| CKM-5305H | Native Human creatine kinase, muscle | +Inquiry |
| CKM-368P | Native Pig Creatine Kinase, Muscle | +Inquiry |
| Ckmm-167R | Native Rat Creatine Kinase MM | +Inquiry |
| CKMM-382H | Native Human Creatine Kinase MM (CK-MM) | +Inquiry |
| CKMM-166M | Native Mouse Creatine Kinase MM | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CKM-7483HCL | Recombinant Human CKM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CKM Products
Required fields are marked with *
My Review for All CKM Products
Required fields are marked with *



