Recombinant Human CLEC12A Protein, GST-tagged
Cat.No. : | CLEC12A-1456H |
Product Overview : | Human CLEC12A partial ORF (ADR82900.1, 108 a.a. - 221 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 108-221 a.a. |
Description : | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. The protein encoded by this gene is a negative regulator of granulocyte and monocyte function. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. This gene is closely linked to other CTL/CTLD superfamily members in the natural killer gene complex region on chromosome 12p13. [provided by RefSeq, May 2011] |
Molecular Mass : | 38.17 kDa |
AA Sequence : | TTLQTIATKLCRELYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIINSSAWVIRNAPD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLEC12A C-type lectin domain family 12, member A [ Homo sapiens ] |
Official Symbol | CLEC12A |
Synonyms | CLEC12A; C-type lectin domain family 12, member A; C-type lectin domain family 12 member A; CLL 1; MICL; C-type lectin superfamily; C-type lectin protein CLL-1; C-type lectin-like molecule-1; dendritic cell-associated lectin 2; myeloid inhibitory C-type lectin-like receptor; CLL1; CLL-1; DCAL-2; MGC70602; |
Gene ID | 160364 |
mRNA Refseq | NM_001207010 |
Protein Refseq | NP_001193939 |
MIM | 612088 |
UniProt ID | Q5QGZ9 |
◆ Recombinant Proteins | ||
CLEC12A-1456H | Recombinant Human CLEC12A Protein, GST-tagged | +Inquiry |
CLEC12A-193H | Recombinant Human CLEC12A protein, His-tagged | +Inquiry |
CLEC12A-20H | Active Recombinant Human CLEC12A Protein (Thr67-Ala265), N-hFc tagged | +Inquiry |
CLEC12A-102R | Recombinant Rat CLEC12A Protein, His-tagged | +Inquiry |
CLEC12A-2115HF | Recombinant Full Length Human CLEC12A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC12A-1920HCL | Recombinant Human CLEC12A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC12A Products
Required fields are marked with *
My Review for All CLEC12A Products
Required fields are marked with *