Recombinant Human CLEC12A Protein, GST-tagged

• Cat.No.: CLEC12A-1456H
• Product Overview: Human CLEC12A partial ORF (ADR82900.1, 108 a.a. - 221 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 108-221 a.a.
• Description: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. The protein encoded by this gene is a negative regulator of granulocyte and monocyte function. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. This gene is closely linked to other CTL/CTLD superfamily members in the natural killer gene complex region on chromosome 12p13. [provided by RefSeq, May 2011]
• Molecular Mass: 38.17 kDa
• AA Sequence: TTLQTIATKLCRELYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIINSSAWVIRNAPD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLEC12A C-type lectin domain family 12, member A [ Homo sapiens ]
• Official Symbol: CLEC12A
• Synonyms: CLEC12A; C-type lectin domain family 12, member A; C-type lectin domain family 12 member A; CLL 1; MICL; C-type lectin superfamily; C-type lectin protein CLL-1; C-type lectin-like molecule-1; dendritic cell-associated lectin 2; myeloid inhibitory C-type lectin-like receptor; CLL1; CLL-1; DCAL-2; MGC70602
• Gene ID: 160364
• mRNA Refseq: NM_001207010
• Protein Refseq: NP_001193939
• MIM: 612088
• UniProt ID: Q5QGZ9