Recombinant Human CLEC12A Protein, GST-tagged

Cat.No. : CLEC12A-1456H
Product Overview : Human CLEC12A partial ORF (ADR82900.1, 108 a.a. - 221 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 108-221 a.a.
Description : This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. The protein encoded by this gene is a negative regulator of granulocyte and monocyte function. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. This gene is closely linked to other CTL/CTLD superfamily members in the natural killer gene complex region on chromosome 12p13. [provided by RefSeq, May 2011]
Molecular Mass : 38.17 kDa
AA Sequence : TTLQTIATKLCRELYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIINSSAWVIRNAPD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLEC12A C-type lectin domain family 12, member A [ Homo sapiens ]
Official Symbol CLEC12A
Synonyms CLEC12A; C-type lectin domain family 12, member A; C-type lectin domain family 12 member A; CLL 1; MICL; C-type lectin superfamily; C-type lectin protein CLL-1; C-type lectin-like molecule-1; dendritic cell-associated lectin 2; myeloid inhibitory C-type lectin-like receptor; CLL1; CLL-1; DCAL-2; MGC70602;
Gene ID 160364
mRNA Refseq NM_001207010
Protein Refseq NP_001193939
MIM 612088
UniProt ID Q5QGZ9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLEC12A Products

Required fields are marked with *

My Review for All CLEC12A Products

Required fields are marked with *

0
cart-icon
0
compare icon