Recombinant Human CLEC2A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CLEC2A-3165H
Product Overview : CLEC2A MS Standard C13 and N15-labeled recombinant protein (NP_001124183) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : CLEC2A belongs to the CLEC2 family of activation-induced, natural killer gene complex-encoded C-type lectin-like receptors.
Molecular Mass : 19.8 kDa
AA Sequence : MINPELRDGRADGFIHRIVPKLIQNWKIGLMCFLSIIITTVCIIMIATWSKHAKPVACSGDWLGVRDKCFYFSDDTRNWTASKIFCSLQKAELAQIDTQEDMEFLKRYAGTDMHWIGLSRKQGDSWKWTNGTTFNGWFEIIGNGSFAFLSADGVHSSRGFIDIKWICSKPKYFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CLEC2A C-type lectin domain family 2 member A [ Homo sapiens (human) ]
Official Symbol CLEC2A
Synonyms CLEC2A; C-type lectin domain family 2, member A; C-type lectin domain family 2 member A; INPE5792; KACL; keratinocyte associated C type lectin; PILAR; proliferation induced lymphocyte associated receptor; UNQ5792; keratinocyte-associated C-type lectin; proliferation-induced lymphocyte-associated receptor;
Gene ID 387836
mRNA Refseq NM_001130711
Protein Refseq NP_001124183
MIM 612087
UniProt ID Q6UVW9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLEC2A Products

Required fields are marked with *

My Review for All CLEC2A Products

Required fields are marked with *

0
cart-icon