Recombinant Human CLEC4E Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CLEC4E-2109H
Product Overview : CLEC4E MS Standard C13 and N15-labeled recombinant protein (NP_055173) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.
Molecular Mass : 25.1 kDa
AA Sequence : MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CLEC4E C-type lectin domain family 4 member E [ Homo sapiens (human) ]
Official Symbol CLEC4E
Synonyms CLEC4E; C-type lectin domain family 4, member E; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 9, CLECSF9; C-type lectin domain family 4 member E; mincle; C-type lectin superfamily member 9; macrophage-inducible C-type lectin; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 9; MINCLE; CLECSF9;
Gene ID 26253
mRNA Refseq NM_014358
Protein Refseq NP_055173
MIM 609962
UniProt ID Q9ULY5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLEC4E Products

Required fields are marked with *

My Review for All CLEC4E Products

Required fields are marked with *

0
cart-icon