Recombinant Human CLEC4E Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CLEC4E-2109H |
| Product Overview : | CLEC4E MS Standard C13 and N15-labeled recombinant protein (NP_055173) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. |
| Molecular Mass : | 25.1 kDa |
| AA Sequence : | MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CLEC4E C-type lectin domain family 4 member E [ Homo sapiens (human) ] |
| Official Symbol | CLEC4E |
| Synonyms | CLEC4E; C-type lectin domain family 4, member E; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 9, CLECSF9; C-type lectin domain family 4 member E; mincle; C-type lectin superfamily member 9; macrophage-inducible C-type lectin; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 9; MINCLE; CLECSF9; |
| Gene ID | 26253 |
| mRNA Refseq | NM_014358 |
| Protein Refseq | NP_055173 |
| MIM | 609962 |
| UniProt ID | Q9ULY5 |
| ◆ Recombinant Proteins | ||
| CLEC4E-290C | Recombinant Cynomolgus CLEC4E protein, Fc-tagged | +Inquiry |
| CLEC4E-1444R | Recombinant Rat CLEC4E Protein | +Inquiry |
| CLEC4E-2160HF | Recombinant Full Length Human CLEC4E Protein, GST-tagged | +Inquiry |
| Clec4e-284M | Active Recombinant Mouse Clec4e protein, Fc-tagged | +Inquiry |
| CLEC4E-0195H | Recombinant Human CLEC4E Protein (G74-L219), His/Strep tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLEC4E-7450HCL | Recombinant Human CLEC4E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC4E Products
Required fields are marked with *
My Review for All CLEC4E Products
Required fields are marked with *
