Recombinant Human CLEC5A protein, His-tagged
| Cat.No. : | CLEC5A-11321H |
| Product Overview : | Recombinant Human CLEC5A protein(32-188 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 16, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 32-188 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | NKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CLEC5A C-type lectin domain family 5, member A [ Homo sapiens ] |
| Official Symbol | CLEC5A |
| Synonyms | CLEC5A; C-type lectin domain family 5, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 5 , CLECSF5; C-type lectin domain family 5 member A; MDL 1; C-type lectin superfamily member 5; myeloid DAP12-associating lectin 1; myeloid DAP12-associating lectin-1; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 5; MDL1; MDL-1; CLECSF5; MGC138304; |
| Gene ID | 23601 |
| mRNA Refseq | NM_013252 |
| Protein Refseq | NP_037384 |
| MIM | 604987 |
| UniProt ID | Q9NY25 |
| ◆ Recombinant Proteins | ||
| CLEC5A-1472H | Recombinant Human CLEC5A Protein, GST-tagged | +Inquiry |
| Clec5a-21R | Recombinant Rat Clec5a, His tagged | +Inquiry |
| CLEC5A-113R | Recombinant Rhesus CLEC5A protein, mFc-tagged | +Inquiry |
| Clec5a-1749M | Recombinant Mouse Clec5a Protein, His (Fc)-Avi-tagged | +Inquiry |
| CLEC5A-6345H | Recombinant Human CLEC5A protein, hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLEC5A-860RCL | Recombinant Rat CLEC5A cell lysate | +Inquiry |
| CLEC5A-815CCL | Recombinant Cynomolgus CLEC5A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC5A Products
Required fields are marked with *
My Review for All CLEC5A Products
Required fields are marked with *
