Recombinant Human CLEC5A Protein, 28-188aa, C-His tagged
Cat.No. : | CLEC5A-20H |
Product Overview : | Recombinant human CLEC5A protein (28-188aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques was expressed in Baculovirus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 28-188aa |
Description : | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein interacts with dnax-activation protein 12 and may play a role in cell activation. Alternative splice variants have been described but their full-length sequence has not been determined. |
Form : | Liquid |
Molecular Mass : | 19.5 kDa (170aa) |
AA Sequence : | ADLPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAKHHHHHH |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 90 % by SDS-PAGE |
Applications : | SDS-PAGE |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 20 % glycerol, 1mM DTT |
Gene Name | CLEC5A C-type lectin domain family 5, member A [ Homo sapiens (human) ] |
Official Symbol | CLEC5A |
Synonyms | CLEC5A; C-type lectin domain family 5, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 5 , CLECSF5; C-type lectin domain family 5 member A; MDL 1; C-type lectin superfamily member 5; myeloid DAP12-associating lectin 1; myeloid DAP12-associating lectin-1; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 5; MDL1; MDL-1; CLECSF5; MGC138304 |
Gene ID | 23601 |
mRNA Refseq | NM_013252 |
Protein Refseq | NP_037384 |
MIM | 604987 |
UniProt ID | Q9NY25 |
◆ Recombinant Proteins | ||
CLEC5A-1750M | Recombinant Mouse CLEC5A Protein, His (Fc)-Avi-tagged | +Inquiry |
CLEC5A-87C | Recombinant Cynomolgus CLEC5A, His tagged | +Inquiry |
Clec5a-06M | Active Recombinant Mouse Clec5a protein, His-tagged | +Inquiry |
CLEC5A-114R | Recombinant Rhesus CLEC5A protein, His-tagged | +Inquiry |
Clec5a-21R | Recombinant Rat Clec5a, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC5A-815CCL | Recombinant Cynomolgus CLEC5A cell lysate | +Inquiry |
CLEC5A-860RCL | Recombinant Rat CLEC5A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLEC5A Products
Required fields are marked with *
My Review for All CLEC5A Products
Required fields are marked with *
0
Inquiry Basket