Recombinant Human CLGN, His-tagged
Cat.No. : | CLGN-52H |
Product Overview : | Recombinant Human Calmegin/CLGN is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu20-Trp471) of Human CLGN fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 20-471 a.a. |
Description : | Calmegin (CLGN) is a member of the calreticulin family. Calmegin is a testis-specific endoplasmic reticulum chaperone protein. Calmegin binds calcium ions and interacts with PDILT. Calmegin may play a role in spermatogeneisis and infertility. |
AA Sequence : | EFMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDM DEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGI DCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPD VDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWD ERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAP QILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFS ALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWVDH HHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | CLGN calmegin [ Homo sapiens ] |
Official Symbol | CLGN |
Synonyms | CLGN; calmegin; |
Gene ID | 1047 |
mRNA Refseq | NM_001130675 |
Protein Refseq | NP_001124147 |
MIM | 601858 |
UniProt ID | O14967 |
Chromosome Location | 4q28.3-q31.1 |
Function | calcium ion binding; unfolded protein binding; |
◆ Recombinant Proteins | ||
CLGN-1475H | Recombinant Human CLGN Protein, GST-tagged | +Inquiry |
CLGN-1660H | Recombinant Human CLGN protein, His & T7-tagged | +Inquiry |
CLGN-2174HF | Recombinant Full Length Human CLGN Protein, GST-tagged | +Inquiry |
CLGN-4754Z | Recombinant Zebrafish CLGN | +Inquiry |
CLGN-1690H | Recombinant Human CLGN Protein (Met1-Trp471), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLGN-7449HCL | Recombinant Human CLGN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLGN Products
Required fields are marked with *
My Review for All CLGN Products
Required fields are marked with *