Recombinant Human CLGN, His-tagged
| Cat.No. : | CLGN-52H | 
| Product Overview : | Recombinant Human Calmegin/CLGN is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu20-Trp471) of Human CLGN fused with a polyhistidine tag at the C-terminus. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | His | 
| Protein Length : | 20-471 a.a. | 
| Description : | Calmegin (CLGN) is a member of the calreticulin family. Calmegin is a testis-specific endoplasmic reticulum chaperone protein. Calmegin binds calcium ions and interacts with PDILT. Calmegin may play a role in spermatogeneisis and infertility. | 
| AA Sequence : | EFMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDM DEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGI DCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPD VDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWD ERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAP QILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFS ALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWVDH HHHHH | 
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). | 
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | 
| Gene Name | CLGN calmegin [ Homo sapiens ] | 
| Official Symbol | CLGN | 
| Synonyms | CLGN; calmegin; | 
| Gene ID | 1047 | 
| mRNA Refseq | NM_001130675 | 
| Protein Refseq | NP_001124147 | 
| MIM | 601858 | 
| UniProt ID | O14967 | 
| Chromosome Location | 4q28.3-q31.1 | 
| Function | calcium ion binding; unfolded protein binding; | 
| ◆ Recombinant Proteins | ||
| CLGN-1035H | Recombinant Human CLGN Protein (Glu20-Trp471), C-His tagged | +Inquiry | 
| CLGN-1475H | Recombinant Human CLGN Protein, GST-tagged | +Inquiry | 
| CLGN-52H | Recombinant Human CLGN, His-tagged | +Inquiry | 
| CLGN-2174HF | Recombinant Full Length Human CLGN Protein, GST-tagged | +Inquiry | 
| CLGN-1660H | Recombinant Human CLGN protein, His & T7-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CLGN-7449HCL | Recombinant Human CLGN 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLGN Products
Required fields are marked with *
My Review for All CLGN Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            