Recombinant Human CLLU1OS Protein, GST-tagged
| Cat.No. : | CLLU1OS-1504H | 
| Product Overview : | Human CLLU1OS full-length ORF ( AAI53087.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | CLLU1OS (Chronic Lymphocytic Leukemia Up-Regulated 1 Opposite Strand) is a Protein Coding gene. Diseases associated with CLLU1OS include Chronic Lymphocytic Leukemia. | 
| Molecular Mass : | 38.06 kDa | 
| AA Sequence : | MNKLGHNELKECLKTATDSLQTVQPSISQTCTSYGPALGAPLPGRNEVALLTSLPPNYEISEGKPRAISAYVRAGKGNVTRRRKKTHLGNDDGKKEAQEKM | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CLLU1OS chronic lymphocytic leukemia up-regulated 1 opposite strand [ Homo sapiens (human) ] | 
| Official Symbol | CLLU1OS | 
| Synonyms | CLLU1OS; chronic lymphocytic leukemia up-regulated 1 opposite strand; Chronic Lymphocytic Leukemia Up-Regulated 1 Opposite Strand; Chronic Lymphocytic Leukemia Up-Regulated 1 Overlapping Strand; putative chronic lymphocytic leukemia up-regulated protein 1 opposite strand transcript protein; chronic lymphocytic leukemia up-regulated 1 overlapping strand | 
| Gene ID | 574016 | 
| mRNA Refseq | NM_001025232 | 
| Protein Refseq | NP_001020403 | 
| MIM | 616989 | 
| UniProt ID | Q5K130 | 
| ◆ Recombinant Proteins | ||
| CLLU1OS-1504H | Recombinant Human CLLU1OS Protein, GST-tagged | +Inquiry | 
| CLLU1OS-3256H | Recombinant Human CLLU1OS Protein, MYC/DDK-tagged | +Inquiry | 
| CLLU1OS-1877HF | Recombinant Full Length Human CLLU1OS Protein, GST-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLLU1OS Products
Required fields are marked with *
My Review for All CLLU1OS Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            