Recombinant Human CLLU1OS Protein, GST-tagged

Cat.No. : CLLU1OS-1504H
Product Overview : Human CLLU1OS full-length ORF ( AAI53087.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CLLU1OS (Chronic Lymphocytic Leukemia Up-Regulated 1 Opposite Strand) is a Protein Coding gene. Diseases associated with CLLU1OS include Chronic Lymphocytic Leukemia.
Molecular Mass : 38.06 kDa
AA Sequence : MNKLGHNELKECLKTATDSLQTVQPSISQTCTSYGPALGAPLPGRNEVALLTSLPPNYEISEGKPRAISAYVRAGKGNVTRRRKKTHLGNDDGKKEAQEKM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLLU1OS chronic lymphocytic leukemia up-regulated 1 opposite strand [ Homo sapiens (human) ]
Official Symbol CLLU1OS
Synonyms CLLU1OS; chronic lymphocytic leukemia up-regulated 1 opposite strand; Chronic Lymphocytic Leukemia Up-Regulated 1 Opposite Strand; Chronic Lymphocytic Leukemia Up-Regulated 1 Overlapping Strand; putative chronic lymphocytic leukemia up-regulated protein 1 opposite strand transcript protein; chronic lymphocytic leukemia up-regulated 1 overlapping strand
Gene ID 574016
mRNA Refseq NM_001025232
Protein Refseq NP_001020403
MIM 616989
UniProt ID Q5K130

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLLU1OS Products

Required fields are marked with *

My Review for All CLLU1OS Products

Required fields are marked with *

0
cart-icon