Recombinant human CLU protein (23-449aa), N-6×His-tagged
Cat.No. : | CLU-13H |
Product Overview : | Recombinant human CLu protein (23-449aa), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-449 |
Description : | The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants. |
Form : | Liquid |
Molecular Mass : | 54.1 kDa (463aa) |
AA Sequence : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE |
Purity : | >85% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol, 1mM DTT |
Gene Name | CLU clusterin [ Homo sapiens (human) ] |
Official Symbol | CLU |
Synonyms | CLU; clusterin; APOJ, CLI, clusterin (complement lysis inhibitor, SP 40,40, sulfated glycoprotein 2, testosterone repressed prostate message 2, apolipoprotein J); apolipoprotein J; complement lysis inhibitor; KUB1; SGP 2; SP 40; sulfated glycoprotein 2; testosterone repressed prostate message 2; TRPM 2; ku70-binding protein 1; aging-associated protein 4; complement cytolysis inhibitor; complement-associated protein SP-40,40; testosterone-repressed prostate message 2; CLI; AAG4; APOJ; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2; MGC24903 |
Gene ID | 1191 |
mRNA Refseq | NM_001831 |
Protein Refseq | NP_001822 |
MIM | 185430 |
UniProt ID | P10909 |
◆ Recombinant Proteins | ||
CLU-6462C | Recombinant Chicken CLU | +Inquiry |
CLU-3661H | Human Clusterin | +Inquiry |
CLU-2707H | Recombinant Human CLU protein, His-tagged | +Inquiry |
CLU-1472R | Recombinant Rat CLU Protein | +Inquiry |
CLU-3893H | Recombinant Human CLU, His tagged | +Inquiry |
◆ Native Proteins | ||
CLU-67H | Native Human Clusterin | +Inquiry |
CLU-19H | Native Human Clusterin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLU-2195MCL | Recombinant Mouse CLU cell lysate | +Inquiry |
CLU-2198HCL | Recombinant Human CLU cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLU Products
Required fields are marked with *
My Review for All CLU Products
Required fields are marked with *