Recombinant Human CLU protein, His-SUMO & Myc-tagged
Cat.No. : | CLU-2706H |
Product Overview : | Recombinant Human CLU protein(P10909)(23-449aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 23-449aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 70.1 kDa |
AA Sequence : | DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CLU clusterin [ Homo sapiens ] |
Official Symbol | CLU |
Synonyms | CLU; clusterin; APOJ, CLI, clusterin (complement lysis inhibitor, SP 40,40, sulfated glycoprotein 2, testosterone repressed prostate message 2, apolipoprotein J); apolipoprotein J; complement lysis inhibitor; KUB1; SGP 2; SP 40; sulfated glycoprotein 2; testosterone repressed prostate message 2; TRPM 2; ku70-binding protein 1; aging-associated protein 4; complement cytolysis inhibitor; complement-associated protein SP-40,40; testosterone-repressed prostate message 2; CLI; AAG4; APOJ; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2; MGC24903; |
Gene ID | 1191 |
mRNA Refseq | NM_001831 |
Protein Refseq | NP_001822 |
MIM | 185430 |
UniProt ID | P10909 |
◆ Recombinant Proteins | ||
CLU-5772C | Recombinant Cattle CLU protein, His & T7-tagged | +Inquiry |
CLU-842H | Recombinant Human CLU Protein, Fc/His-tagged | +Inquiry |
CLU-266H | Recombinant Human clusterin Protein, His&Flag tagged | +Inquiry |
CLU-4585H | Recombinant Human CLU Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CLU-3661H | Human Clusterin | +Inquiry |
◆ Native Proteins | ||
CLU-67H | Native Human Clusterin | +Inquiry |
CLU-19H | Native Human Clusterin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLU-2195MCL | Recombinant Mouse CLU cell lysate | +Inquiry |
CLU-2198HCL | Recombinant Human CLU cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLU Products
Required fields are marked with *
My Review for All CLU Products
Required fields are marked with *