Recombinant Human CLU protein, His-tagged
Cat.No. : | CLU-2550H |
Product Overview : | Recombinant Human CLU protein(101-449 aa), fused to His tag, was expressed in E. coli. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 101-449 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CLU clusterin [ Homo sapiens ] |
Official Symbol | CLU |
Synonyms | CLU; clusterin; APOJ, CLI, clusterin (complement lysis inhibitor, SP 40,40, sulfated glycoprotein 2, testosterone repressed prostate message 2, apolipoprotein J); apolipoprotein J; complement lysis inhibitor; KUB1; SGP 2; SP 40; sulfated glycoprotein 2; testosterone repressed prostate message 2; TRPM 2; ku70-binding protein 1; aging-associated protein 4; complement cytolysis inhibitor; complement-associated protein SP-40,40; testosterone-repressed prostate message 2; CLI; AAG4; APOJ; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2; MGC24903; |
Gene ID | 1191 |
mRNA Refseq | NM_001831 |
Protein Refseq | NP_001822 |
MIM | 185430 |
UniProt ID | P10909 |
◆ Recombinant Proteins | ||
CLU-3893H | Recombinant Human CLU, His tagged | +Inquiry |
CLU-3277H | Recombinant Human CLU Protein, MYC/DDK-tagged | +Inquiry |
CLU-5777R | Recombinant Rabbit CLU protein, His-tagged | +Inquiry |
CLU-841H | Recombinant Human CLU Protein | +Inquiry |
CLU-11H | Recombinant Human CLU protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CLU-19H | Native Human Clusterin Protein | +Inquiry |
CLU-67H | Native Human Clusterin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLU-2198HCL | Recombinant Human CLU cell lysate | +Inquiry |
CLU-2195MCL | Recombinant Mouse CLU cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLU Products
Required fields are marked with *
My Review for All CLU Products
Required fields are marked with *
0
Inquiry Basket