| Species : | Human | 
                                
                                    | Source : | E.coli | 
                                
                                    | Tag : | GST | 
                                
                                    | Protein Length : | 265-327 aa | 
                                
                                    | Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). | 
                                
                                    | AASequence : | LLDHEYDDDSEYNVDSYSMPVKEVEKELSPKSMKRSQSVVDPTVLKRMDKNEEENMQPLLSLD | 
                                
                                    | Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
                                
                                    | Storage : | Store at 2-8°C for 1-2 weeks.
Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
                                
                                    | Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |