Recombinant Human CMC1 Protein, GST-tagged
| Cat.No. : | CMC1-1535H | 
| Product Overview : | Human CMC1 full-length ORF (AAH52644.1, 1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | CMC1 (C-X9-C Motif Containing 1) is a Protein Coding gene. | 
| Molecular Mass : | 38.06 kDa | 
| AA Sequence : | MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CMC1 COX assembly mitochondrial protein 1 homolog (S. cerevisiae) [ Homo sapiens ] | 
| Official Symbol | CMC1 | 
| Synonyms | C3orf68 | 
| Gene ID | 152100 | 
| mRNA Refseq | NM_182523.1 | 
| Protein Refseq | NP_872329.1 | 
| MIM | 616990 | 
| UniProt ID | Q7Z7K0 | 
| ◆ Recombinant Proteins | ||
| CMC1-5776H | Recombinant Human CMC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| CMC1-15906H | Recombinant Human CMC1, His-tagged | +Inquiry | 
| CMC1-753R | Recombinant Rhesus Macaque CMC1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CMC1-1535H | Recombinant Human CMC1 Protein, GST-tagged | +Inquiry | 
| CMC1-1901HF | Recombinant Full Length Human CMC1 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CMC1-7420HCL | Recombinant Human CMC1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMC1 Products
Required fields are marked with *
My Review for All CMC1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            