Recombinant Human CMC1 Protein, GST-tagged

Cat.No. : CMC1-1535H
Product Overview : Human CMC1 full-length ORF (AAH52644.1, 1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CMC1 (C-X9-C Motif Containing 1) is a Protein Coding gene.
Molecular Mass : 38.06 kDa
AA Sequence : MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CMC1 COX assembly mitochondrial protein 1 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol CMC1
Synonyms C3orf68
Gene ID 152100
mRNA Refseq NM_182523.1
Protein Refseq NP_872329.1
MIM 616990
UniProt ID Q7Z7K0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CMC1 Products

Required fields are marked with *

My Review for All CMC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon