Recombinant Human CMC1 Protein, GST-tagged
Cat.No. : | CMC1-1535H |
Product Overview : | Human CMC1 full-length ORF (AAH52644.1, 1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CMC1 (C-X9-C Motif Containing 1) is a Protein Coding gene. |
Molecular Mass : | 38.06 kDa |
AA Sequence : | MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CMC1 COX assembly mitochondrial protein 1 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | CMC1 |
Synonyms | C3orf68 |
Gene ID | 152100 |
mRNA Refseq | NM_182523.1 |
Protein Refseq | NP_872329.1 |
MIM | 616990 |
UniProt ID | Q7Z7K0 |
◆ Recombinant Proteins | ||
CMC1-12512Z | Recombinant Zebrafish CMC1 | +Inquiry |
CMC1-1535H | Recombinant Human CMC1 Protein, GST-tagged | +Inquiry |
CMC1-928R | Recombinant Rhesus monkey CMC1 Protein, His-tagged | +Inquiry |
Cmc1-2206M | Recombinant Mouse Cmc1 Protein, Myc/DDK-tagged | +Inquiry |
CMC1-15906H | Recombinant Human CMC1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CMC1-7420HCL | Recombinant Human CMC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMC1 Products
Required fields are marked with *
My Review for All CMC1 Products
Required fields are marked with *