Recombinant Human CMPK2 Protein, GST-tagged
Cat.No. : | CMPK2-1542H |
Product Overview : | Human CMPK2 partial ORF ( NP_997198, 151 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes one of the enzymes in the nucleotide synthesis salvage pathway that may participate in terminal differentiation of monocytic cells. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | GACQEAPRPHLGEFEADPRGQLWQRLWEVQDGRRLQVGCAQVVPVPEPPLHPVVPDLPSSVVFPDREAARAVLEECTSFIPEARAVLDLVDQCPKQIQKG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CMPK2 cytidine monophosphate (UMP-CMP) kinase 2, mitochondrial [ Homo sapiens ] |
Official Symbol | CMPK2 |
Synonyms | CMPK2; cytidine monophosphate (UMP-CMP) kinase 2, mitochondrial; UMP-CMP kinase 2, mitochondrial; cytidylate kinase 2; TYKi; UMP CMPK2; mitochondrial UMP-CMP kinase; thymidine monophosphate kinase 2; thymidylate kinase family LPS-inducible member; TMPK2; UMP-CMPK2; |
Gene ID | 129607 |
mRNA Refseq | NM_001256477 |
Protein Refseq | NP_001243406 |
MIM | 611787 |
UniProt ID | Q5EBM0 |
◆ Recombinant Proteins | ||
CMPK2-1008HFL | Recombinant Full Length Human CMPK2 Protein, C-Flag-tagged | +Inquiry |
CMPK2-1083H | Recombinant Human CMPK2 | +Inquiry |
CMPK2-1787M | Recombinant Mouse CMPK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CMPK2-1542H | Recombinant Human CMPK2 Protein, GST-tagged | +Inquiry |
CMPK2-625H | Recombinant Human CMPK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMPK2 Products
Required fields are marked with *
My Review for All CMPK2 Products
Required fields are marked with *