Recombinant Human CMPK2 Protein, GST-tagged

Cat.No. : CMPK2-1542H
Product Overview : Human CMPK2 partial ORF ( NP_997198, 151 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes one of the enzymes in the nucleotide synthesis salvage pathway that may participate in terminal differentiation of monocytic cells. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]
Molecular Mass : 36.74 kDa
AA Sequence : GACQEAPRPHLGEFEADPRGQLWQRLWEVQDGRRLQVGCAQVVPVPEPPLHPVVPDLPSSVVFPDREAARAVLEECTSFIPEARAVLDLVDQCPKQIQKG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CMPK2 cytidine monophosphate (UMP-CMP) kinase 2, mitochondrial [ Homo sapiens ]
Official Symbol CMPK2
Synonyms CMPK2; cytidine monophosphate (UMP-CMP) kinase 2, mitochondrial; UMP-CMP kinase 2, mitochondrial; cytidylate kinase 2; TYKi; UMP CMPK2; mitochondrial UMP-CMP kinase; thymidine monophosphate kinase 2; thymidylate kinase family LPS-inducible member; TMPK2; UMP-CMPK2;
Gene ID 129607
mRNA Refseq NM_001256477
Protein Refseq NP_001243406
MIM 611787
UniProt ID Q5EBM0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CMPK2 Products

Required fields are marked with *

My Review for All CMPK2 Products

Required fields are marked with *

0
cart-icon
0
compare icon