Recombinant Full Length Human CMPK2 Protein, C-Flag-tagged
| Cat.No. : | CMPK2-1008HFL | 
| Product Overview : | Recombinant Full Length Human CMPK2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Mammalian Cells | 
| Tag : | Flag | 
| Description : | This gene encodes one of the enzymes in the nucleotide synthesis salvage pathway that may participate in terminal differentiation of monocytic cells. Multiple transcript variants encoding different isoforms have been found for this gene. | 
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
| Molecular Mass : | 49.3 kDa | 
| AA Sequence : | MAFARRLLRGPLSGPLLGRRGVCAGAMAPPRRFVLELPDCTLAHFALGADAPGDADAPDPRLAALLGPPE RSYSLCVPVTPDAGCGARVRAARLHQRLLHQLRRGPFQRCQLLRLLCYCPGGQAGGAQQGFLLRDPLDDP DTRQALLELLGACQEAPRPHLGEFEADPRGQLWQRLWEVQDGRRLQVGCAQVVPVPEPPLHPVVPDLPSS VVFPDREAARAVLEECTSFIPEARAVLDLVDQCPKQIQKGKFQVVAIEGLDATGKTTVTQSVADSLKAVL LKSPPSCIGQWRKIFDDEPTIIRRAFYSLGNYIVASEIAKESAKSPVIVDRYWHSTATYAIATEVSGGLQ HLPPAHHPVYQWPEDLLKPDLILLLTVSPEERLQRLQGRGMEKTREEAELEANSVFRQKVEMSYQRMENP GCHVVDASPSREKVLQTVLSLIQNSFSEPTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Storage : | Store at -80 centigrade. | 
| Concentration : | >50 ug/mL as determined by microplate BCA method. | 
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Protein Pathways : | Metabolic pathways, Pyrimidine metabolism | 
| Full Length : | Full L. | 
| Gene Name | CMPK2 cytidine/uridine monophosphate kinase 2 [ Homo sapiens (human) ] | 
| Official Symbol | CMPK2 | 
| Synonyms | NDK; TYKi; TMPK2; UMP-CMPK2 | 
| Gene ID | 129607 | 
| mRNA Refseq | NM_207315.4 | 
| Protein Refseq | NP_997198.2 | 
| MIM | 611787 | 
| UniProt ID | Q5EBM0 | 
| ◆ Recombinant Proteins | ||
| Cmpk2-2209M | Recombinant Mouse Cmpk2 Protein, Myc/DDK-tagged | +Inquiry | 
| CMPK2-1008HFL | Recombinant Full Length Human CMPK2 Protein, C-Flag-tagged | +Inquiry | 
| CMPK2-3630M | Recombinant Mouse CMPK2 Protein | +Inquiry | 
| CMPK2-1787M | Recombinant Mouse CMPK2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CMPK2-1542H | Recombinant Human CMPK2 Protein, GST-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMPK2 Products
Required fields are marked with *
My Review for All CMPK2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            