Recombinant Human CMTM4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CMTM4-2824H |
Product Overview : | CMTM4 MS Standard C13 and N15-labeled recombinant protein (NP_852662) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Molecular Mass : | 22.7 kDa |
AA Sequence : | MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFICIETIMACSPCEGLYFFEFVSCSAFVVTGVLLIMFSLNLHMRIPQINWNLTDLVNTGLSAFLFFIASIVLAALNHRAGAEIAAVIFGFLETAAYAVNTFLAVQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CMTM4 CKLF-like MARVEL transmembrane domain containing 4 [ Homo sapiens (human) ] |
Official Symbol | CMTM4 |
Synonyms | CMTM4; CKLF-like MARVEL transmembrane domain containing 4; chemokine like factor super family 4, chemokine like factor superfamily 4, CKLFSF4; CKLF-like MARVEL transmembrane domain-containing protein 4; chemokine-like factor super family 4; chemokine-like factor superfamily member 4; CKLFSF4; |
Gene ID | 146223 |
mRNA Refseq | NM_181521 |
Protein Refseq | NP_852662 |
MIM | 607887 |
UniProt ID | Q8IZR5 |
◆ Recombinant Proteins | ||
CMTM4-2824H | Recombinant Human CMTM4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CMTM4-620Z | Recombinant Zebrafish CMTM4 | +Inquiry |
CMTM4-3635M | Recombinant Mouse CMTM4 Protein | +Inquiry |
Cmtm4-2211M | Recombinant Mouse Cmtm4 Protein, Myc/DDK-tagged | +Inquiry |
CMTM4-674HF | Recombinant Full Length Human CMTM4 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMTM4 Products
Required fields are marked with *
My Review for All CMTM4 Products
Required fields are marked with *