Recombinant Human CNOT1 Protein, GST-tagged
| Cat.No. : | CNOT1-1576H |
| Product Overview : | Human CNOT1 partial ORF ( NP_057368, 2278 a.a. - 2375 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CNOT1 (CCR4-NOT Transcription Complex Subunit 1) is a Protein Coding gene. Diseases associated with CNOT1 include Iritis. Among its related pathways are Deadenylation-dependent mRNA decay and Gene Expression. GO annotations related to this gene include poly(A) RNA binding and protein domain specific binding. |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | NSHTHYFSCTMLYLFAEANTEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPAFKFWNHEFVHCAPEIEKLFQSVAQCCMGQKQAQQVMEGTGA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CNOT1 CCR4-NOT transcription complex, subunit 1 [ Homo sapiens ] |
| Official Symbol | CNOT1 |
| Synonyms | CCR4-NOT transcription complex, subunit 1; CCR4-associated factor 1; NOT1; AD-005; CDC39; adrenal gland protein AD-005; NOT1H; CCR4-NOT transcription complex subunit 1; KIAA1007; NOT1 (negative regulator of transcription 1, yeast) homolog; Negative regulator of transcription subunit 1 homolog; hNOT1; CNOT1 |
| Gene ID | 23019 |
| mRNA Refseq | NM_016284.4 |
| Protein Refseq | NP_057368.3 |
| MIM | 604917 |
| UniProt ID | A5YKK6 |
| ◆ Recombinant Proteins | ||
| CNOT1-1576H | Recombinant Human CNOT1 Protein, GST-tagged | +Inquiry |
| CNOT1-4911Z | Recombinant Zebrafish CNOT1 | +Inquiry |
| CNOT1-11393H | Recombinant Human CNOT1, His-tagged | +Inquiry |
| CNOT1-4731C | Recombinant Chicken CNOT1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNOT1 Products
Required fields are marked with *
My Review for All CNOT1 Products
Required fields are marked with *
