"CNOT8" Related Products

Expand
Expand
Expand

Recombinant Human CNOT8 protein, T7/His-tagged

Cat.No.: CNOT8-156H
Product Overview: Recombinant human POP2 (291aa, derived from BC017366) protein fused with T7-His-TEV cleavage site Tag (29aa)at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVV VRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQ FQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKY LMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNE DVDSAQEKMSILAIINNMQQ
Purity: >90% by SDS-PAGE
Applications: 1. May serve as auto-antibodies detection reagent, which will react with sera of some autoimmune-diseases patients.2. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. May be used for POP2 protein-protein interaction mapping.4. As immunogen for specific antibody production.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: CNOT8 CCR4-NOT transcription complex, subunit 8 [ Homo sapiens ]
Official Symbol: CNOT8
Synonyms: CNOT8; CAF1; CALIF; hCAF1; PGK promoter directed over production; CAF2; CALIFp; CAF1-like protein; CCR4-associated factor 8;
Gene ID: 9337
mRNA Refseq: NM_004779
Protein Refseq: NP_004770
MIM: 603731
UniProt ID: Q9UFF9
Chromosome Location: 5q31-q33
Pathway: Deadenylation of mRNA, organism-specific biosystem; Deadenylation-dependent mRNA decay, organism-specific biosystem; Gene Expression, organism-specific biosystem; RNA degradation, organism-specific biosystem; RNA degradation, conserved biosystem;
Function: nucleic acid binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.