Recombinant Human CNRIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CNRIP1-1837H |
Product Overview : | CNRIP1 MS Standard C13 and N15-labeled recombinant protein (NP_056278) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein that interacts with the C-terminal tail of cannabinoid receptor 1. Two transcript variants encoding different isoforms have been described for this gene. |
Molecular Mass : | 18.6 kDa |
AA Sequence : | MGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CNRIP1 cannabinoid receptor interacting protein 1 [ Homo sapiens (human) ] |
Official Symbol | CNRIP1 |
Synonyms | CNRIP1; cannabinoid receptor interacting protein 1; C2orf32, chromosome 2 open reading frame 32; CB1 cannabinoid receptor-interacting protein 1; CRIP1; CRIP1a; CRIP1b; DKFZP566K1924; CRIP-1; cannabinoid receptor CB1-interacting protein 1; C2orf32; DKFZp566K1924; |
Gene ID | 25927 |
mRNA Refseq | NM_015463 |
Protein Refseq | NP_056278 |
MIM | 618538 |
UniProt ID | Q96F85 |
◆ Recombinant Proteins | ||
CNRIP1-1824M | Recombinant Mouse CNRIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNRIP1-773R | Recombinant Rhesus Macaque CNRIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNRIP1-1960HF | Recombinant Full Length Human CNRIP1 Protein, GST-tagged | +Inquiry |
CNRIP1-1602H | Recombinant Human CNRIP1 Protein, GST-tagged | +Inquiry |
CNRIP1-948R | Recombinant Rhesus monkey CNRIP1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNRIP1-7393HCL | Recombinant Human CNRIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNRIP1 Products
Required fields are marked with *
My Review for All CNRIP1 Products
Required fields are marked with *