Recombinant Human CNRIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CNRIP1-1837H
• Product Overview: CNRIP1 MS Standard C13 and N15-labeled recombinant protein (NP_056278) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein that interacts with the C-terminal tail of cannabinoid receptor 1. Two transcript variants encoding different isoforms have been described for this gene.
• Molecular Mass: 18.6 kDa
• AA Sequence: MGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CNRIP1 cannabinoid receptor interacting protein 1 [ Homo sapiens (human) ]
• Official Symbol: CNRIP1
• Synonyms: CNRIP1; cannabinoid receptor interacting protein 1; C2orf32, chromosome 2 open reading frame 32; CB1 cannabinoid receptor-interacting protein 1; CRIP1; CRIP1a; CRIP1b; DKFZP566K1924; CRIP-1; cannabinoid receptor CB1-interacting protein 1; C2orf32; DKFZp566K1924
• Gene ID: 25927
• mRNA Refseq: NM_015463
• Protein Refseq: NP_056278
• MIM: 618538
• UniProt ID: Q96F85