Recombinant Human CNTFR Protein, GST-tagged

Cat.No. : CNTFR-1607H
Product Overview : Human CNTFR partial ORF ( NP_671693, 47 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the type 1 cytokine receptor family. The encoded protein is the ligand-specific component of a tripartite receptor for ciliary neurotrophic factor, which plays a critical role in neuronal cell survival, differentiation and gene expression. Binding of ciliary neurotrophic factor to the encoded protein recruits the transmembrane components of the receptor, gp130 and leukemia inhibitory factor receptor, facilitating signal transduction. Single nucleotide polymorphisms in this gene may be associated with variations in muscle strength, as well as early onset of eating disorders. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, May 2011]
Molecular Mass : 38.06 kDa
AA Sequence : GTANWDAAVTWRVNGTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CNTFR ciliary neurotrophic factor receptor [ Homo sapiens ]
Official Symbol CNTFR
Synonyms CNTFR; ciliary neurotrophic factor receptor; ciliary neurotrophic factor receptor subunit alpha; CNTFR-alpha; CNTF receptor subunit alpha; MGC1774;
Gene ID 1271
mRNA Refseq NM_001207011
Protein Refseq NP_001193940
MIM 118946
UniProt ID P26992

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNTFR Products

Required fields are marked with *

My Review for All CNTFR Products

Required fields are marked with *

0
cart-icon