Recombinant Human CNTFR Protein, GST-tagged
Cat.No. : | CNTFR-1607H |
Product Overview : | Human CNTFR partial ORF ( NP_671693, 47 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the type 1 cytokine receptor family. The encoded protein is the ligand-specific component of a tripartite receptor for ciliary neurotrophic factor, which plays a critical role in neuronal cell survival, differentiation and gene expression. Binding of ciliary neurotrophic factor to the encoded protein recruits the transmembrane components of the receptor, gp130 and leukemia inhibitory factor receptor, facilitating signal transduction. Single nucleotide polymorphisms in this gene may be associated with variations in muscle strength, as well as early onset of eating disorders. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, May 2011] |
Molecular Mass : | 38.06 kDa |
AA Sequence : | GTANWDAAVTWRVNGTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNTFR ciliary neurotrophic factor receptor [ Homo sapiens ] |
Official Symbol | CNTFR |
Synonyms | CNTFR; ciliary neurotrophic factor receptor; ciliary neurotrophic factor receptor subunit alpha; CNTFR-alpha; CNTF receptor subunit alpha; MGC1774; |
Gene ID | 1271 |
mRNA Refseq | NM_001207011 |
Protein Refseq | NP_001193940 |
MIM | 118946 |
UniProt ID | P26992 |
◆ Recombinant Proteins | ||
CNTFR-178H | Recombinant Human CNTFR | +Inquiry |
CNTFR-3334H | Active Recombinant Human CNTFR protein, His-tagged | +Inquiry |
CNTFR-1753H | Recombinant Human CNTFR Protein (Thr120-Leu358), His tagged | +Inquiry |
CNTFR-184H | Recombinant Human CNTFR Protein, His-tagged | +Inquiry |
CNTFR-381H | Recombinant Human CNTFR Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNTFR-687HCL | Recombinant Human CNTFR cell lysate | +Inquiry |
CNTFR-598RCL | Recombinant Rat CNTFR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNTFR Products
Required fields are marked with *
My Review for All CNTFR Products
Required fields are marked with *