Recombinant Human CNTNAP1 Protein (26-356 aa), His-SUMO-tagged
Cat.No. : | CNTNAP1-417H |
Product Overview : | Recombinant Human CNTNAP1 Protein (26-356 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 26-356 aa |
Description : | Ses to play a role in the formation of functional distinct domains critical for saltatory conduction of nerve impulses in myelinated nerve fibers. Ses to darcate the paranodal region of the axo-glial junction. In association with contactin may have a role in the signaling between axons and myelinating glial cells. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 53.8 kDa |
AA Sequence : | DEELVGPLYARSLGASSYYSLLTAPRFARLHGISGWSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNSTFFGNVNESAVVRHDLHFHFTARYIRIVPLAWNPRGKIGLRLGLYGCPYKADILYFDGDDAISYRFPRGVSRSLWDVFAFSFKTEEKDGLLLHAEGAQGDYVTLELEGAHLLLHMSLGSSPIQPRPGHTTVSAGGVLNDQHWHYVRVDRFGRDVNFTLDGYVQRFILNGDFERLNLDTEMFIGGLVGAARKNLAYRHNFRGCIENVIFNRVNIADLAVRRHSRITFEGKVAFRCL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | CNTNAP1 contactin associated protein 1 [ Homo sapiens ] |
Official Symbol | CNTNAP1 |
Synonyms | P190; CASPR; NRXN4; CNTNAP |
Gene ID | 8506 |
mRNA Refseq | NM_003632.2 |
Protein Refseq | NP_003623.1 |
MIM | 602346 |
UniProt ID | P78357 |
◆ Recombinant Proteins | ||
CNTNAP1-952R | Recombinant Rhesus monkey CNTNAP1 Protein, His-tagged | +Inquiry |
CNTNAP1-777R | Recombinant Rhesus Macaque CNTNAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNTNAP1-2245H | Recombinant Human CNTNAP1 Protein (Pro926-Glu1190), N-His tagged | +Inquiry |
CNTNAP1-3691M | Recombinant Mouse CNTNAP1 Protein | +Inquiry |
CNTNAP1-5753H | Recombinant Human CNTNAP1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNTNAP1-7390HCL | Recombinant Human CNTNAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNTNAP1 Products
Required fields are marked with *
My Review for All CNTNAP1 Products
Required fields are marked with *
0
Inquiry Basket