Recombinant Human CNTNAP1 Protein, GST-tagged
Cat.No. : | CNTNAP1-1611H |
Product Overview : | Human CNTNAP1 partial ORF ( NP_003623, 22 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The gene product was initially identified as a 190-kD protein associated with the contactin-PTPRZ1 complex. The 1,384-amino acid protein, also designated p190 or CASPR for 'contactin-associated protein,' includes an extracellular domain with several putative protein-protein interaction domains, a putative transmembrane domain, and a 74-amino acid cytoplasmic domain. Northern blot analysis showed that the gene is transcribed predominantly in brain as a transcript of 6.2 kb, with weak expression in several other tissues tested. The architecture of its extracellular domain is similar to that of neurexins, and this protein may be the signaling subunit of contactin, enabling recruitment and activation of intracellular signaling pathways in neurons. [provided by RefSeq, Jan 2009] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | YYGCDEELVGPLYARSLGASSYYSLLTAPRFARLHGISGWSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNSTFFGNVNESA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNTNAP1 contactin associated protein 1 [ Homo sapiens ] |
Official Symbol | CNTNAP1 |
Synonyms | P190; CASPR; NRXN4; CNTNAP |
Gene ID | 8506 |
mRNA Refseq | NM_003632.2 |
Protein Refseq | NP_003623.1 |
MIM | 602346 |
UniProt ID | P78357 |
◆ Recombinant Proteins | ||
CNTNAP1-417H | Recombinant Human CNTNAP1 Protein (26-356 aa), His-SUMO-tagged | +Inquiry |
CNTNAP1-5753H | Recombinant Human CNTNAP1 protein, His & T7-tagged | +Inquiry |
CNTNAP1-1831M | Recombinant Mouse CNTNAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNTNAP1-3691M | Recombinant Mouse CNTNAP1 Protein | +Inquiry |
CNTNAP1-1509R | Recombinant Rat CNTNAP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNTNAP1-7390HCL | Recombinant Human CNTNAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNTNAP1 Products
Required fields are marked with *
My Review for All CNTNAP1 Products
Required fields are marked with *