Recombinant Human CNTNAP1 Protein, GST-tagged

Cat.No. : CNTNAP1-1611H
Product Overview : Human CNTNAP1 partial ORF ( NP_003623, 22 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The gene product was initially identified as a 190-kD protein associated with the contactin-PTPRZ1 complex. The 1,384-amino acid protein, also designated p190 or CASPR for 'contactin-associated protein,' includes an extracellular domain with several putative protein-protein interaction domains, a putative transmembrane domain, and a 74-amino acid cytoplasmic domain. Northern blot analysis showed that the gene is transcribed predominantly in brain as a transcript of 6.2 kb, with weak expression in several other tissues tested. The architecture of its extracellular domain is similar to that of neurexins, and this protein may be the signaling subunit of contactin, enabling recruitment and activation of intracellular signaling pathways in neurons. [provided by RefSeq, Jan 2009]
Molecular Mass : 37.84 kDa
AA Sequence : YYGCDEELVGPLYARSLGASSYYSLLTAPRFARLHGISGWSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNSTFFGNVNESA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CNTNAP1 contactin associated protein 1 [ Homo sapiens ]
Official Symbol CNTNAP1
Synonyms P190; CASPR; NRXN4; CNTNAP
Gene ID 8506
mRNA Refseq NM_003632.2
Protein Refseq NP_003623.1
MIM 602346
UniProt ID P78357

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNTNAP1 Products

Required fields are marked with *

My Review for All CNTNAP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon