Recombinant Human CNTNAP5 Protein, GST-tagged

Cat.No. : CNTNAP5-1613H
Product Overview : Human CNTNAP5 partial ORF ( NP_570129, 1062 a.a. - 1160 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene product belongs to the neurexin family, members of which function in the vertebrate nervous system as cell adhesion molecules and receptors. This protein, like other neurexin proteins, contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, and thrombospondin N-terminal-like domains. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.63 kDa
AA Sequence : DFVVVLLCKNGSLQVRYHLNKEETHVFTIDADNFANRRMHHLKINREGRELTIQMDQQLRLSYNFSPEVEFRVIRSLTLGKVTENLGLDSEVAKANAMG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CNTNAP5 contactin associated protein like 5 [ Homo sapiens (human) ]
Official Symbol CNTNAP5
Synonyms CNTNAP5; contactin associated protein like 5; Contactin Associated Protein Like 5; Cell Recognition Molecule Caspr5; Caspr5; Contactin Associated Protein-Like 5; Contactin-Associated Protein-Like 5; caspr5; contactin-associated protein-like 5; cell recognition molecule Caspr5
Gene ID 129684
mRNA Refseq NM_130773
Protein Refseq NP_570129
MIM 610519
UniProt ID Q8WYK1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNTNAP5 Products

Required fields are marked with *

My Review for All CNTNAP5 Products

Required fields are marked with *

0
cart-icon
0
compare icon