Recombinant Human COA1 Protein (38-146 aa), GST-tagged
Cat.No. : | COA1-371H |
Product Overview : | Recombinant Human COA1 Protein (38-146 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cancer. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 38-146 aa |
Description : | Component of some MITRAC complex, a cytochrome c oxidase (COX) assbly intermediate complex that regulates COX assbly. MITRAC complexes regulate both translation of mitochondrial encoded components and assbly of nuclear-encoded components imported in mitochondrion. Required for assbly of mitochondrial respiratory chain complex I and complex IV. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 39.4 kDa |
AA Sequence : | QKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | COA1 cytochrome c oxidase assembly factor 1 homolog [ Homo sapiens (human) ] |
Official Symbol | COA1 |
Synonyms | C7orf44; MITRAC15; |
Gene ID | 55744 |
mRNA Refseq | NM_001321197 |
Protein Refseq | NP_001308126 |
UniProt ID | Q9GZY4 |
◆ Recombinant Proteins | ||
COA1-2708H | Recombinant Human COA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COA1-954R | Recombinant Rhesus monkey COA1 Protein, His-tagged | +Inquiry |
COA1-4224H | Recombinant Human COA1 Protein, GST-tagged | +Inquiry |
COA1-4847HF | Recombinant Full Length Human COA1 Protein, GST-tagged | +Inquiry |
COA1-779R | Recombinant Rhesus Macaque COA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COA1-628HCL | Recombinant Human COA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COA1 Products
Required fields are marked with *
My Review for All COA1 Products
Required fields are marked with *