Recombinant Human COA1 Protein (38-146 aa), GST-tagged

• Cat.No.: COA1-371H
• Product Overview: Recombinant Human COA1 Protein (38-146 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cancer. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 38-146 aa
• Description: Component of some MITRAC complex, a cytochrome c oxidase (COX) assbly intermediate complex that regulates COX assbly. MITRAC complexes regulate both translation of mitochondrial encoded components and assbly of nuclear-encoded components imported in mitochondrion. Required for assbly of mitochondrial respiratory chain complex I and complex IV.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 39.4 kDa
• AA Sequence: QKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: COA1 cytochrome c oxidase assembly factor 1 homolog [ Homo sapiens (human) ]
• Official Symbol: COA1
• Synonyms: C7orf44; MITRAC15
• Gene ID: 55744
• mRNA Refseq: NM_001321197
• Protein Refseq: NP_001308126
• UniProt ID: Q9GZY4