Recombinant Human COA1 Protein (38-146 aa), GST-tagged
| Cat.No. : | COA1-371H |
| Product Overview : | Recombinant Human COA1 Protein (38-146 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cancer. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 38-146 aa |
| Description : | Component of some MITRAC complex, a cytochrome c oxidase (COX) assbly intermediate complex that regulates COX assbly. MITRAC complexes regulate both translation of mitochondrial encoded components and assbly of nuclear-encoded components imported in mitochondrion. Required for assbly of mitochondrial respiratory chain complex I and complex IV. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 39.4 kDa |
| AA Sequence : | QKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | COA1 cytochrome c oxidase assembly factor 1 homolog [ Homo sapiens (human) ] |
| Official Symbol | COA1 |
| Synonyms | C7orf44; MITRAC15; |
| Gene ID | 55744 |
| mRNA Refseq | NM_001321197 |
| Protein Refseq | NP_001308126 |
| UniProt ID | Q9GZY4 |
| ◆ Recombinant Proteins | ||
| COA1-954R | Recombinant Rhesus monkey COA1 Protein, His-tagged | +Inquiry |
| COA1-371H | Recombinant Human COA1 Protein (38-146 aa), GST-tagged | +Inquiry |
| COA1-779R | Recombinant Rhesus Macaque COA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| COA1-4847HF | Recombinant Full Length Human COA1 Protein, GST-tagged | +Inquiry |
| COA1-2708H | Recombinant Human COA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COA1-628HCL | Recombinant Human COA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COA1 Products
Required fields are marked with *
My Review for All COA1 Products
Required fields are marked with *



