Recombinant Human COA5 Protein, GST-tagged
Cat.No. : | COA5-1614H |
Product Overview : | Human COA5 full-length ORF ( ADR82642.1, 1 a.a. - 74 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an ortholog of yeast Pet191, which in yeast is a subunit of a large oligomeric complex associated with the mitochondrial inner membrane, and required for the assembly of the cytochrome c oxidase complex. Mutations in this gene are associated with mitochondrial complex IV deficiency, a disorder of the mitochondrial respiratory chain with heterogeneous clinical manifestations, ranging from isolated myopathy to a severe disease affecting several tissues and organs. [provided by RefSeq, Dec 2011] |
Molecular Mass : | 8.2 kDa |
AA Sequence : | MPKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFRGRKGY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COA5 cytochrome c oxidase assembly factor 5 [ Homo sapiens (human) ] |
Official Symbol | COA5 |
Synonyms | COA5; cytochrome c oxidase assembly factor 5; Cytochrome C Oxidase Assembly Factor 5; C2orf64; Chromosome 2 Open Reading Frame 64; Protein C2orf64; 6330578E17Rik; CEMCOX3; Pet191; Pet191; C2orf64; CEMCOX3; 6330578E17Rik; cytochrome c oxidase assembly factor 5; protein C2orf64 |
Gene ID | 493753 |
mRNA Refseq | NM_001008215 |
Protein Refseq | NP_001008216 |
MIM | 613920 |
UniProt ID | Q86WW8 |
◆ Recombinant Proteins | ||
COA5-7509Z | Recombinant Zebrafish COA5 | +Inquiry |
COA5-1837M | Recombinant Mouse COA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
COA5-1614H | Recombinant Human COA5 Protein, GST-tagged | +Inquiry |
COA5-3699M | Recombinant Mouse COA5 Protein | +Inquiry |
COA5-955R | Recombinant Rhesus monkey COA5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COA5-8067HCL | Recombinant Human C2orf64 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COA5 Products
Required fields are marked with *
My Review for All COA5 Products
Required fields are marked with *