Recombinant Human COG8 Protein, GST-tagged
Cat.No. : | COG8-1631H |
Product Overview : | Human COG8 full-length ORF ( AAH17492.1, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that is a component of the conserved oligomeric Golgi (COG) complex, a multiprotein complex that plays a structural role in the Golgi apparatus, and is involved in intracellular membrane trafficking and glycoprotein modification. Mutations in this gene cause congenital disorder of glycosylation, type IIh, a disease that is characterized by under-glycosylated serum proteins, and whose symptoms include severe psychomotor retardation, failure to thrive, seizures, and dairy and wheat product intolerance. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 49.7 kDa |
AA Sequence : | MNSYMLISAPAILGTSNMPAAVPATQPGTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGALEDALAKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPLAFILPKRETLFTLDDQALGPELTAPAPEPPAEEPRLEPAGPACPEGGRAETQAEPPSVGP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COG8 component of oligomeric golgi complex 8 [ Homo sapiens ] |
Official Symbol | COG8 |
Synonyms | COG8; component of oligomeric golgi complex 8; conserved oligomeric Golgi complex subunit 8; DOR1; FLJ22315; dependent on RIC1; COG complex subunit 8; conserved oligomeric golgi complex component 8; CDG2H; |
Gene ID | 84342 |
mRNA Refseq | NM_032382 |
Protein Refseq | NP_115758 |
MIM | 606979 |
UniProt ID | Q96MW5 |
◆ Recombinant Proteins | ||
COG8-2176Z | Recombinant Zebrafish COG8 | +Inquiry |
COG8-1641H | Recombinant Human COG8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COG8-2085HF | Recombinant Full Length Human COG8 Protein, GST-tagged | +Inquiry |
COG8-11422H | Recombinant Human COG8, GST-tagged | +Inquiry |
COG8-1631H | Recombinant Human COG8 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COG8-7381HCL | Recombinant Human COG8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COG8 Products
Required fields are marked with *
My Review for All COG8 Products
Required fields are marked with *