Recombinant Human COL11A2 Protein, GST-tagged

• Cat.No.: COL11A2-1635H
• Product Overview: Human COL11A2 partial ORF ( NP_542411, 29 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes one of the two alpha chains of type XI collagen, a minor fibrillar collagen. It is located on chromosome 6 very close to but separate from the gene for retinoid X receptor beta. Type XI collagen is a heterotrimer but the third alpha chain is a post-translationally modified alpha 1 type II chain. Proteolytic processing of this type XI chain produces PARP, a proline/arginine-rich protein that is an amino terminal domain. Mutations in this gene are associated with type III Stickler syndrome, otospondylomegaepiphyseal dysplasia (OSMED syndrome), Weissenbacher-Zweymuller syndrome, autosomal dominant non-syndromic sensorineural type 13 deafness (DFNA13), and autosomal recessive non-syndromic sensorineural type 53 deafness (DFNB53). Alternative splicing results in multiple transcript variants. A related pseudogene is located nearby on chromosome 6. [provided by RefSeq, Jul 2009]
• Molecular Mass: 36.74 kDa
• AA Sequence: APPVDVLRALRFPSLPDGVRRAKGICPADVAYRVARPAQLSAPTRQLFPGGFPKDFSLLTVVRTRPGLQAPLLTLYSAQGVRQLGLELGRPVRFLYEDQT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COL11A2 collagen, type XI, alpha 2 [ Homo sapiens ]
• Official Symbol: COL11A2
• Synonyms: COL11A2; collagen, type XI, alpha 2; DFNA13, DFNB53; collagen alpha-2(XI) chain; HKE5; pro-a2 chain of collagen type XI; PARP; STL3; FBCG2; DFNA13; DFNB53
• Gene ID: 1302
• mRNA Refseq: NM_001163771
• Protein Refseq: NP_001157243
• MIM: 120290
• UniProt ID: P13942