Recombinant Human COL11A2 Protein, GST-tagged

Cat.No. : COL11A2-1635H
Product Overview : Human COL11A2 partial ORF ( NP_542411, 29 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes one of the two alpha chains of type XI collagen, a minor fibrillar collagen. It is located on chromosome 6 very close to but separate from the gene for retinoid X receptor beta. Type XI collagen is a heterotrimer but the third alpha chain is a post-translationally modified alpha 1 type II chain. Proteolytic processing of this type XI chain produces PARP, a proline/arginine-rich protein that is an amino terminal domain. Mutations in this gene are associated with type III Stickler syndrome, otospondylomegaepiphyseal dysplasia (OSMED syndrome), Weissenbacher-Zweymuller syndrome, autosomal dominant non-syndromic sensorineural type 13 deafness (DFNA13), and autosomal recessive non-syndromic sensorineural type 53 deafness (DFNB53). Alternative splicing results in multiple transcript variants. A related pseudogene is located nearby on chromosome 6. [provided by RefSeq, Jul 2009]
Molecular Mass : 36.74 kDa
AA Sequence : APPVDVLRALRFPSLPDGVRRAKGICPADVAYRVARPAQLSAPTRQLFPGGFPKDFSLLTVVRTRPGLQAPLLTLYSAQGVRQLGLELGRPVRFLYEDQT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COL11A2 collagen, type XI, alpha 2 [ Homo sapiens ]
Official Symbol COL11A2
Synonyms COL11A2; collagen, type XI, alpha 2; DFNA13, DFNB53; collagen alpha-2(XI) chain; HKE5; pro-a2 chain of collagen type XI; PARP; STL3; FBCG2; DFNA13; DFNB53;
Gene ID 1302
mRNA Refseq NM_001163771
Protein Refseq NP_001157243
MIM 120290
UniProt ID P13942

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COL11A2 Products

Required fields are marked with *

My Review for All COL11A2 Products

Required fields are marked with *

0
cart-icon
0
compare icon