Recombinant Human COL1A1 protein
| Cat.No. : | COL1A1-71H |
| Product Overview : | Recombinant Human collagen-I CBF8 domain cDNA fragment (26 - 542 aa) fused with N-terminal fusion of human VTN (61-398aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 26-542 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGID SRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFT RINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQH QPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAP RPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRGGGGSGGGGSNIEFGPAGPPGRDGIPGQPGLPGPPGPP GPPGPPGLGGNFAPQLSYGYDEKSTGGISVPGPMGPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGP PGPPGKNGDDGEAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGA PGQMGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGPRGSEGPQGVRGE PGPPGPAGAAGPAGNPGADGQPGAKGANGA |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro human hepatocytes differentiation ascoating matrix protein.2. May be used as culture matrix protein for long term liver cells cultivation in vitro. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | COL1A1 collagen, type I, alpha 1 [ Homo sapiens ] |
| Official Symbol | COL1A1 |
| Synonyms | COL1A1; collagen, type I, alpha 1; collagen alpha-1(I) chain; OI4; alpha-1 type I collagen; pro-alpha-1 collagen type 1; collagen alpha 1 chain type I; collagen alpha-1(I) chain preproprotein; collagen of skin, tendon and bone, alpha-1 chain; |
| Gene ID | 1277 |
| mRNA Refseq | NM_000088 |
| Protein Refseq | NP_000079 |
| MIM | |
| UniProt ID | P02452 |
| Chromosome Location | 17q21.33 |
| Pathway | Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Axon guidance, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; |
| Function | extracellular matrix structural constituent; identical protein binding; platelet-derived growth factor binding; protein binding; |
| ◆ Recombinant Proteins | ||
| COL1A1-113H | Recombinant Human COL1A1, GST-tagged | +Inquiry |
| Col1a1-1277M | Recombinant Mouse Col1a1 Protein, His-tagged | +Inquiry |
| COL1A1-1761H | Recombinant Human COL1A1 Protein (Gly1094-Leu1464), His tagged | +Inquiry |
| COL1A1-1756H | Recombinant Human COL1A1 Protein (Ala396-Asp744), N-His tagged | +Inquiry |
| COL1A1-1760H | Recombinant Human COL1A1 Protein (Gln23-Pro161), N-His tagged | +Inquiry |
| ◆ Native Proteins | ||
| Col1a1-7174M | Native Mouse Col1a1 Protein | +Inquiry |
| COL1A1-23M | Native Mouse Collagen I Protein | +Inquiry |
| COL1A1-26195TH | Native Human COL1A1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COL1A1 Products
Required fields are marked with *
My Review for All COL1A1 Products
Required fields are marked with *
