Recombinant Human COL21A1 Protein, GST-tagged

Cat.No. : COL21A1-1640H
Product Overview : Human COL21A1 partial ORF ( NP_110447, 221 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the alpha chain of type XXI collagen, a member of the FACIT (fibril-associated collagens with interrupted helices) collagen family. Type XXI collagen is localized to tissues containing type I collagen and maintains the integrity of the extracellular matrix. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Molecular Mass : 36.74 kDa
AA Sequence : IPVAARDERGFDILLGLDVNKKVKKRIQLSPKKIKGYEVTSKVDLSELTSNVFPEGLPPSYVFVSTQRFKVKKIWDLWRILTIDGRPQIAVTLNGVDKIL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COL21A1 collagen, type XXI, alpha 1 [ Homo sapiens ]
Official Symbol COL21A1
Synonyms COL21A1; collagen, type XXI, alpha 1; collagen alpha-1(XXI) chain; alpha 1 type XXI collagen; alpha 1 chain-like collagen; FP633; COLA1L; dJ708F5.1; dJ682J15.1; FLJ39125; FLJ44623; MGC26619; DKFZp564B052;
Gene ID 81578
mRNA Refseq NM_030820
Protein Refseq NP_110447
MIM 610002
UniProt ID Q96P44

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COL21A1 Products

Required fields are marked with *

My Review for All COL21A1 Products

Required fields are marked with *

0
cart-icon