Recombinant Human COL4A3 protein, His-tagged
| Cat.No. : | COL4A3-2715H |
| Product Overview : | Recombinant Human COL4A3 protein(Q01955)(1427-1668aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1427-1668aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.6 kDa |
| AA Sequence : | GLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) [ Homo sapiens ] |
| Official Symbol | COL4A3 |
| Synonyms | COL4A3; collagen, type IV, alpha 3 (Goodpasture antigen); collagen alpha-3(IV) chain; tumstatin; collagen IV, alpha-3 polypeptide; |
| Gene ID | 1285 |
| mRNA Refseq | NM_000091 |
| Protein Refseq | NP_000082 |
| MIM | 120070 |
| UniProt ID | Q01955 |
| ◆ Recombinant Proteins | ||
| COL4A3-1864M | Recombinant Mouse COL4A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Col4a3-8807R | Recombinant Rat Col4a3 protein(Gly1426-His1670), hFc-tagged | +Inquiry |
| COL4A3-179H | Recombinant Human COL4A3 | +Inquiry |
| COL4A3-2715H | Recombinant Human COL4A3 protein, His-tagged | +Inquiry |
| COL4A3-2714H | Recombinant Human COL4A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COL4A3-1219RCL | Recombinant Rat COL4A3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COL4A3 Products
Required fields are marked with *
My Review for All COL4A3 Products
Required fields are marked with *
