Recombinant Human COL4A5 protein, GST-tagged
Cat.No. : | COL4A5-11435H |
Product Overview : | Recombinant Human COL4A5 protein(423-552 aa), fused with GST tag, was expressed in E.coli. |
Availability | August 31, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 423-552 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | GLDGQPGAPGLPGPPGPAGPHIPPSDEICEPGPPGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPGLPGLPGPPGSLGFPGQKGEKGQAGATGPKGLPGIPGAPGAPGFPGSKGEPGDILT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | COL4A5 collagen, type IV, alpha 5 [ Homo sapiens ] |
Official Symbol | COL4A5 |
Synonyms | Arresten; Canstatin; CO4A1_HUMAN; COL4A1; COL4A1 NC1 domain; COL4A2; COL4A3; COL4A4; COL4A5; Collagen Alpha 1(IV) Chain; Collagen Alpha 2(IV) Chain; collagen alpha-1(IV) chain; Collagen IV Alpha 1 Polypeptide; Collagen IV Alpha 2 Polypeptide; Collagen Of Basement Membrane Alpha 1 Chain; Collagen Of Basement Membrane Alpha 2 Chain; Collagen Type IV Alpha 1; Collagen Type IV Alpha 2; Collagen Type IV Alpha 3; Collagen Type IV Alpha 4; Collagen Type IV Alpha 5; DKFZp686I14213; FLJ22259; |
Gene ID | 1287 |
mRNA Refseq | NM_033380.2 |
Protein Refseq | NP_203699.1 |
MIM | 303630 |
UniProt ID | A7MBN3 |
◆ Recombinant Proteins | ||
COL4A5-332H | Recombinant Human COL4A5 Protein, His-tagged | +Inquiry |
COL4A5-6854H | Recombinant Human COL4A5 protein, GST-tagged | +Inquiry |
COL4A5-11435H | Recombinant Human COL4A5 protein, GST-tagged | +Inquiry |
COL4A5-6638Z | Recombinant Zebrafish COL4A5 | +Inquiry |
COL4A5-6855H | Recombinant Human COL4A5 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COL4A5 Products
Required fields are marked with *
My Review for All COL4A5 Products
Required fields are marked with *