Recombinant Human COL8A2 Protein, GST-tagged
Cat.No. : | COL8A2-1661H |
Product Overview : | Human COL8A2 full-length ORF ( AAH96296.1, 1 a.a. - 427 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the alpha 2 chain of type VIII collagen. This protein is a major component of the basement membrane of the corneal endothelium and forms homo- or heterotrimers with alpha 1 (VIII) type collagens. Defects in this gene are associated with Fuchs endothelial corneal dystrophy and posterior polymorphous corneal dystrophy type 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014] |
Molecular Mass : | 68.9 kDa |
AA Sequence : | MLGTLTPLSSLLLLLLVLVLGCGPRASSGGGAGGAAGYAPVKYIQPMQKGPVGPPFREGKGQYLEMPLPLLPMDLKGEPGPPGKPGPRGPPGPPGFPGKPGMGKPGLHGQPGPAGPPGFSRMGKAGPPGLPGKVGPPGQPGLRGEPGIRGDQGLRGPPGPPGLPGPSGITIPGKPGAQGVPGPPGFQGEPGPQGEPGPPGDRGLKGDNGVGQPGLPGAPGQGGAPGPPGLPGPAGLGKPGLDGLPGAPGDKGESGPPGAFDETGIAGLHLPNGGVEGAVLGKGGKPQFGLGELSAHATPAFTAVLTSPFPASGMPVKFDRTLYNGHSGYNPATGIFTCPVGGVYYFAYHVHVKGTNVWVALYKNNVPATYTYDEYKKGYLDQASGGAVLQLRPNDQVWVQMPSDQANGLYSTEYIHSSFSGFLLCPT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COL8A2 collagen, type VIII, alpha 2 [ Homo sapiens ] |
Official Symbol | COL8A2 |
Synonyms | COL8A2; collagen, type VIII, alpha 2; FECD; collagen alpha-2(VIII) chain; PPCD; PPCD2; endothelial collagen; collagen VIII, alpha-2 polypeptide; dJ665N4.1 (collagen type VIII alpha 2); FECD1; FLJ00201; MGC116970; MGC116972; |
Gene ID | 1296 |
mRNA Refseq | NM_005202 |
Protein Refseq | NP_005193 |
MIM | 120252 |
UniProt ID | P25067 |
◆ Recombinant Proteins | ||
COL8A2-1771H | Recombinant Human COL8A2 Protein (Gln396-Thr703), N-His tagged | +Inquiry |
COL8A2-7886H | Recombinant Human COL8A2 protein, His-tagged | +Inquiry |
Col8a2-2244M | Recombinant Mouse Col8a2 Protein, Myc/DDK-tagged | +Inquiry |
COL8A2-1661H | Recombinant Human COL8A2 Protein, GST-tagged | +Inquiry |
COL8A2-2180HF | Recombinant Full Length Human COL8A2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COL8A2-7375HCL | Recombinant Human COL8A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COL8A2 Products
Required fields are marked with *
My Review for All COL8A2 Products
Required fields are marked with *
0
Inquiry Basket