Recombinant Human collapsin response mediator protein 1 protein, His tagged
Cat.No. : | CRMP1-12HFL |
Product Overview : | Recombinant human CRMP1 (1-572 aa), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-572 aa |
Description : | This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants. |
Tag : | N-His |
Form : | Liquid |
Molecular Mass : | 64.8 kDa (597aa) |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSEFMSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol, 1mM DTT, 0.2mM PMSF |
Concentration : | 1 mg/mL (determined by Bradford assay) |
Reference : | 1. Shih J.-Y. et al. (2001) J. Natl. Cancer Inst. 93:1392-1400. 2. Chen T.C. et al. (2009) J. Proteome Res. 8:4943-4953. |
Gene Name | CRMP1 collapsin response mediator protein 1 [ Homo sapiens (human) ] |
Official Symbol | CRMP1 |
Synonyms | CRMP1; collapsin response mediator protein 1; dihydropyrimidinase-related protein 1; DPYSL1; DRP 1; dihydropyrimidinase-like 1; unc-33-like phosphoprotein 3; dihydropyrimidinase related protein-1; DRP1; DRP-1; CRMP-1; ULIP-3 |
Gene ID | 1400 |
mRNA Refseq | NM_001313 |
Protein Refseq | NP_001304 |
MIM | 602462 |
UniProt ID | Q14194 |
◆ Recombinant Proteins | ||
CRMP1-635H | Recombinant Human CRMP1 Protein, His-tagged | +Inquiry |
CRMP1-1172H | Recombinant Full Length Human CRMP1 Protein | +Inquiry |
CRMP1-110H | Recombinant Human Collapsin Response Mediator Protein 1 | +Inquiry |
CRMP1-662H | Recombinant Human CRMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRMP1-524HFL | Recombinant Full Length Human CRMP1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRMP1-7273HCL | Recombinant Human CRMP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRMP1 Products
Required fields are marked with *
My Review for All CRMP1 Products
Required fields are marked with *
0
Inquiry Basket