Recombinant Human COMMD4 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | COMMD4-1206H |
| Product Overview : | COMMD4 MS Standard C13 and N15-labeled recombinant protein (NP_060298) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | COMMD4 (COMM Domain Containing 4) is a Protein Coding gene. |
| Molecular Mass : | 21.6 kDa |
| AA Sequence : | MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | COMMD4 COMM domain containing 4 [ Homo sapiens (human) ] |
| Official Symbol | COMMD4 |
| Synonyms | COMMD4; COMM domain containing 4; COMM domain-containing protein 4; FLJ20452; |
| Gene ID | 54939 |
| mRNA Refseq | NM_017828 |
| Protein Refseq | NP_060298 |
| MIM | 616701 |
| UniProt ID | Q9H0A8 |
| ◆ Recombinant Proteins | ||
| COMMD4-5012C | Recombinant Chicken COMMD4 | +Inquiry |
| COMMD4-1942HF | Recombinant Full Length Human COMMD4 Protein, GST-tagged | +Inquiry |
| COMMD4-3299H | Recombinant Human COMMD4 Protein, MYC/DDK-tagged | +Inquiry |
| COMMD4-1210H | Recombinant Human COMMD4 Protein (1-195 aa), GST-tagged | +Inquiry |
| COMMD4-5011C | Recombinant Chicken COMMD4 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMMD4 Products
Required fields are marked with *
My Review for All COMMD4 Products
Required fields are marked with *



