Recombinant Human COMMD4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | COMMD4-1206H |
Product Overview : | COMMD4 MS Standard C13 and N15-labeled recombinant protein (NP_060298) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | COMMD4 (COMM Domain Containing 4) is a Protein Coding gene. |
Molecular Mass : | 21.6 kDa |
AA Sequence : | MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | COMMD4 COMM domain containing 4 [ Homo sapiens (human) ] |
Official Symbol | COMMD4 |
Synonyms | COMMD4; COMM domain containing 4; COMM domain-containing protein 4; FLJ20452; |
Gene ID | 54939 |
mRNA Refseq | NM_017828 |
Protein Refseq | NP_060298 |
MIM | 616701 |
UniProt ID | Q9H0A8 |
◆ Recombinant Proteins | ||
COMMD4-1210H | Recombinant Human COMMD4 Protein (1-195 aa), GST-tagged | +Inquiry |
COMMD4-4574Z | Recombinant Zebrafish COMMD4 | +Inquiry |
COMMD4-1877M | Recombinant Mouse COMMD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Commd4-2249M | Recombinant Mouse Commd4 Protein, Myc/DDK-tagged | +Inquiry |
COMMD4-5011C | Recombinant Chicken COMMD4 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMMD4 Products
Required fields are marked with *
My Review for All COMMD4 Products
Required fields are marked with *