Recombinant Human COMMD4 Protein, GST-tagged

Cat.No. : COMMD4-1681H
Product Overview : Human COMMD4 full-length ORF ( NP_060298.2, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : COMMD4 (COMM Domain Containing 4) is a Protein Coding gene.
Molecular Mass : 48.2 kDa
AA Sequence : MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COMMD4 COMM domain containing 4 [ Homo sapiens ]
Official Symbol COMMD4
Synonyms COMMD4; COMM domain containing 4; COMM domain-containing protein 4; FLJ20452;
Gene ID 54939
mRNA Refseq NM_017828
Protein Refseq NP_060298
MIM 616701
UniProt ID Q9H0A8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COMMD4 Products

Required fields are marked with *

My Review for All COMMD4 Products

Required fields are marked with *

0
cart-icon