Recombinant Human COMMD5 protein, His-tagged
Cat.No. : | COMMD5-3490H |
Product Overview : | Recombinant Human COMMD5 protein(4-159 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 4-159 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQRLGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDSVAQQQGAWLPHVADFRWRV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | COMMD5 COMM domain containing 5 [ Homo sapiens ] |
Official Symbol | COMMD5 |
Synonyms | COMM domain containing 5; FLJ13008; HCaRG; HT002Hypertension-related calcium-regulated gene protein; COMM domain-containing protein 5HCARG; COMMD5 |
Gene ID | 28991 |
mRNA Refseq | NM_014066.3 |
Protein Refseq | NP_054785.2 |
MIM | 608216 |
UniProt ID | Q9GZQ3 |
◆ Recombinant Proteins | ||
Commd5-2250M | Recombinant Mouse Commd5 Protein, Myc/DDK-tagged | +Inquiry |
COMMD5-1878M | Recombinant Mouse COMMD5 Protein, His (Fc)-Avi-tagged | +Inquiry |
COMMD5-1351H | Recombinant Human COMMD5 protein, His-tagged | +Inquiry |
COMMD5-2691H | Recombinant Human COMMD5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COMMD5-0386H | Recombinant Human COMMD5 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMMD5-7369HCL | Recombinant Human COMMD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMMD5 Products
Required fields are marked with *
My Review for All COMMD5 Products
Required fields are marked with *