Recombinant Human COMTD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: COMTD1-2570H
• Product Overview: COMTD1 MS Standard C13 and N15-labeled recombinant protein (NP_653190) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Putative O-methyltransferase.
• Molecular Mass: 28.8 kDa
• AA Sequence: MTQPVPRLSVPAALALGSAALGAAFATGLFLGRRCPPWRGRREQCLLPPEDSRLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLGDGLTLAFKITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: COMTD1 catechol-O-methyltransferase domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: COMTD1
• Synonyms: COMTD1; catechol-O-methyltransferase domain containing 1; catechol O-methyltransferase domain-containing protein 1; FLJ23841
• Gene ID: 118881
• mRNA Refseq: NM_144589
• Protein Refseq: NP_653190
• UniProt ID: Q86VU5