Recombinant Human COMTD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : COMTD1-2570H
Product Overview : COMTD1 MS Standard C13 and N15-labeled recombinant protein (NP_653190) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Putative O-methyltransferase.
Molecular Mass : 28.8 kDa
AA Sequence : MTQPVPRLSVPAALALGSAALGAAFATGLFLGRRCPPWRGRREQCLLPPEDSRLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLGDGLTLAFKITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name COMTD1 catechol-O-methyltransferase domain containing 1 [ Homo sapiens (human) ]
Official Symbol COMTD1
Synonyms COMTD1; catechol-O-methyltransferase domain containing 1; catechol O-methyltransferase domain-containing protein 1; FLJ23841;
Gene ID 118881
mRNA Refseq NM_144589
Protein Refseq NP_653190
UniProt ID Q86VU5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COMTD1 Products

Required fields are marked with *

My Review for All COMTD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon