Recombinant Human COMTD1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | COMTD1-2570H |
Product Overview : | COMTD1 MS Standard C13 and N15-labeled recombinant protein (NP_653190) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Putative O-methyltransferase. |
Molecular Mass : | 28.8 kDa |
AA Sequence : | MTQPVPRLSVPAALALGSAALGAAFATGLFLGRRCPPWRGRREQCLLPPEDSRLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLGDGLTLAFKITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | COMTD1 catechol-O-methyltransferase domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | COMTD1 |
Synonyms | COMTD1; catechol-O-methyltransferase domain containing 1; catechol O-methyltransferase domain-containing protein 1; FLJ23841; |
Gene ID | 118881 |
mRNA Refseq | NM_144589 |
Protein Refseq | NP_653190 |
UniProt ID | Q86VU5 |
◆ Recombinant Proteins | ||
Comtd1-2255M | Recombinant Mouse Comtd1 Protein, Myc/DDK-tagged | +Inquiry |
RFL31530HF | Recombinant Full Length Human Catechol O-Methyltransferase Domain-Containing Protein 1(Comtd1) Protein, His-Tagged | +Inquiry |
COMTD1-1949HF | Recombinant Full Length Human COMTD1 Protein, GST-tagged | +Inquiry |
COMTD1-3772M | Recombinant Mouse COMTD1 Protein | +Inquiry |
COMTD1-1881M | Recombinant Mouse COMTD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMTD1-7364HCL | Recombinant Human COMTD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMTD1 Products
Required fields are marked with *
My Review for All COMTD1 Products
Required fields are marked with *