Recombinant Human COPE protein, His-tagged
| Cat.No. : | COPE-3920H |
| Product Overview : | Recombinant Human COPE protein(1-308 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | June 20, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 1-308 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVLDEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRALHQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRLVLQYAPSA |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | COPE coatomer protein complex, subunit epsilon [ Homo sapiens ] |
| Official Symbol | COPE |
| Synonyms | COPE; coatomer protein complex, subunit epsilon; coatomer subunit epsilon; epsilon COP; epsilon coat protein; epsilon-coat protein; coatomer epsilon subunit; epsilon-COP; FLJ13241; |
| mRNA Refseq | NM_007263 |
| Protein Refseq | NP_009194 |
| MIM | 606942 |
| UniProt ID | O14579 |
| Gene ID | 11316 |
| ◆ Recombinant Proteins | ||
| COPE-1952HF | Recombinant Full Length Human COPE Protein, GST-tagged | +Inquiry |
| COPE-11456H | Recombinant Human COPE protein, GST-tagged | +Inquiry |
| COPE-1752Z | Recombinant Zebrafish COPE | +Inquiry |
| COPE-970R | Recombinant Rhesus monkey COPE Protein, His-tagged | +Inquiry |
| COPE-3776M | Recombinant Mouse COPE Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COPE-7361HCL | Recombinant Human COPE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COPE Products
Required fields are marked with *
My Review for All COPE Products
Required fields are marked with *
