Recombinant Human COPE protein, GST-tagged
Cat.No. : | COPE-11456H |
Product Overview : | Recombinant Human COPE protein(1-308 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | July 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-308 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVLDEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRALHQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRLVLQYAPSA |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | COPE coatomer protein complex, subunit epsilon [ Homo sapiens ] |
Official Symbol | COPE |
Synonyms | COPE; coatomer protein complex, subunit epsilon; coatomer subunit epsilon; epsilon COP; epsilon coat protein; epsilon-coat protein; coatomer epsilon subunit; epsilon-COP; FLJ13241; |
mRNA Refseq | NM_007263 |
Protein Refseq | NP_009194 |
MIM | 606942 |
UniProt ID | O14579 |
Gene ID | 11316 |
◆ Recombinant Proteins | ||
COPE-649H | Recombinant Human coatomer protein complex, subunit epsilon, His-tagged | +Inquiry |
COPE-3920H | Recombinant Human COPE protein, His-tagged | +Inquiry |
COPE-3776M | Recombinant Mouse COPE Protein | +Inquiry |
COPE-1884M | Recombinant Mouse COPE Protein, His (Fc)-Avi-tagged | +Inquiry |
COPE-3597H | Recombinant Human COPE Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPE-7361HCL | Recombinant Human COPE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COPE Products
Required fields are marked with *
My Review for All COPE Products
Required fields are marked with *