Recombinant Full Length Human COPE Protein, GST-tagged
| Cat.No. : | COPE-1952HF |
| Product Overview : | Human COPE full-length ORF ( NP_009194.2, 1 a.a. - 308 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 308 amino acids |
| Description : | The product of this gene is an epsilon subunit of coatomer protein complex. Coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles. It is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. Coatomer complex consists of at least the alpha, beta, beta', gamma, delta, epsilon and zeta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 60.9 kDa |
| AA Sequence : | MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVLDEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRALHQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRLVLQYAPSA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | COPE coatomer protein complex, subunit epsilon [ Homo sapiens ] |
| Official Symbol | COPE |
| Synonyms | COPE; coatomer protein complex, subunit epsilon; coatomer subunit epsilon; epsilon COP; epsilon coat protein; epsilon-coat protein; coatomer epsilon subunit; epsilon-COP; FLJ13241 |
| Gene ID | 11316 |
| mRNA Refseq | NM_007263 |
| Protein Refseq | NP_009194 |
| MIM | 606942 |
| UniProt ID | O14579 |
| ◆ Recombinant Proteins | ||
| COPE-649H | Recombinant Human coatomer protein complex, subunit epsilon, His-tagged | +Inquiry |
| COPE-1952HF | Recombinant Full Length Human COPE Protein, GST-tagged | +Inquiry |
| COPE-970R | Recombinant Rhesus monkey COPE Protein, His-tagged | +Inquiry |
| COPE-1884M | Recombinant Mouse COPE Protein, His (Fc)-Avi-tagged | +Inquiry |
| COPE-1695H | Recombinant Human COPE Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COPE-7361HCL | Recombinant Human COPE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COPE Products
Required fields are marked with *
My Review for All COPE Products
Required fields are marked with *
